KEGG   Homo sapiens (human): 84868
Entry
84868             CDS       T01001                                 

Gene name
HAVCR2, CD366, HAVcr-2, KIM-3, SPTCL, TIM3, TIMD-3, TIMD3, Tim-3
Definition
(RefSeq) hepatitis A virus cellular receptor 2
  KO
K20414  hepatitis A virus cellular receptor 2
Organism
hsa  Homo sapiens (human)
Drug target
Cobolimab: D11377
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    84868 (HAVCR2)
CD molecules [BR:hsa04090]
 Proteins
  84868 (HAVCR2)
SSDB
Motif
Pfam: V-set ig Ig_2 I-set Ig_3 Ig_6 Receptor_2B4
Other DBs
NCBI-GeneID: 84868
NCBI-ProteinID: NP_116171
OMIM: 606652
HGNC: 18437
Ensembl: ENSG00000135077
Vega: OTTHUMG00000130249
Pharos: Q8TDQ0(Tbio)
UniProt: Q8TDQ0
Structure
PDB: 
6DHB 5F71

Position
5q33.3
AA seq 301 aa
MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPV
FECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMND
EKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLA
NELRDSRLANDLRDSGATIRIGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLI
SLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEYYCYVSSRQQPSQPLGCRFAM
P
NT seq 906 nt   +upstreamnt  +downstreamnt
atgttttcacatcttccctttgactgtgtcctgctgctgctgctgctactacttacaagg
tcctcagaagtggaatacagagcggaggtcggtcagaatgcctatctgccctgcttctac
accccagccgccccagggaacctcgtgcccgtctgctggggcaaaggagcctgtcctgtg
tttgaatgtggcaacgtggtgctcaggactgatgaaagggatgtgaattattggacatcc
agatactggctaaatggggatttccgcaaaggagatgtgtccctgaccatagagaatgtg
actctagcagacagtgggatctactgctgccggatccaaatcccaggcataatgaatgat
gaaaaatttaacctgaagttggtcatcaaaccagccaaggtcacccctgcaccgactcgg
cagagagacttcactgcagcctttccaaggatgcttaccaccaggggacatggcccagca
gagacacagacactggggagcctccctgatataaatctaacacaaatatccacattggcc
aatgagttacgggactctagattggccaatgacttacgggactctggagcaaccatcaga
ataggcatctacatcggagcagggatctgtgctgggctggctctggctcttatcttcggc
gctttaattttcaaatggtattctcatagcaaagagaagatacagaatttaagcctcatc
tctttggccaacctccctccctcaggattggcaaatgcagtagcagagggaattcgctca
gaagaaaacatctataccattgaagagaacgtatatgaagtggaggagcccaatgagtat
tattgctatgtcagcagcaggcagcaaccctcacaacctttgggttgtcgctttgcaatg
ccatag

DBGET integrated database retrieval system