KEGG   Homo sapiens (human): 84869
Entry
84869             CDS       T01001                                 
Symbol
CBR4, SDR45C1
Name
(RefSeq) carbonyl reductase 4
  KO
K11539  carbonyl reductase 4 / 3-oxoacyl-[acyl-carrier protein] reductase beta subunit [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    84869 (CBR4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-
     84869 (CBR4)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Sacchrp_dh_NADP NAD_binding_10 Glyco_transf_5 Epimerase
Other DBs
NCBI-GeneID: 84869
NCBI-ProteinID: NP_116172
OMIM: 619394
HGNC: 25891
Ensembl: ENSG00000145439
Pharos: Q8N4T8(Tbio)
UniProt: Q8N4T8
Structure
Position
4:complement(168894486..169010255)
AA seq 237 aa
MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKE
HDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMR
TMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGF
VHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
NT seq 714 nt   +upstreamnt  +downstreamnt
atggacaaagtgtgtgctgtttttggaggctcccgaggcattggcagagctgtggcccag
ttaatggcccggaaaggctaccgactggcggtcattgccagaaacctggaaggggccaaa
gccgccgccggtgacctcggcggagatcatttggcatttagctgtgatgttgctaaagaa
catgatgttcaaaatacatttgaagagctggagaaacatttaggtcgagtaaatttcttg
gtaaatgcagctggtattaacagggatggtcttttagtaagaacaaaaactgaagatatg
gtatctcagcttcatactaacctcttgggttccatgctgacctgtaaagctgccatgagg
actatgattcaacaacagggagggtctattgttaatgtaggaagcattgttggcttaaaa
ggcaactctggccagtccgtttacagtgccagtaaaggaggattagttggattttcacgt
gctcttgctaaagaggtagcaagaaagaaaattagagtgaatgtagttgcaccaggattt
gtacacacagatatgacgaaagacttgaaagaagaacatttaaagaaaaatattcctctt
gggaggtttggagaaactattgaggtggcacatgcggttgtgtttcttttagaatcaccg
tatattacagggcatgttctggtagtggatgggggattacaactcattttgtaa

DBGET integrated database retrieval system