KEGG   Homo sapiens (human): 84872
Entry
84872             CDS       T01001                                 
Symbol
ZC3H10, ZC3HDC10
Name
(RefSeq) zinc finger CCCH-type containing 10
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus zf-CCCH_3 bZIP_1 MbeD_MobD TSC22 ZapB DivIC
Other DBs
NCBI-GeneID: 84872
NCBI-ProteinID: NP_001290053
HGNC: 25893
Ensembl: ENSG00000135482
UniProt: Q96K80
Position
12:56118266..56127514
AA seq 434 aa
MPDRDSYANGTGSSGGGPGGGGSEEASGAGVGSGGASSDAICRDFLRNVCKRGKRCRYRH
PDMSEVSNLGVSKNEFIFCHDFQNKECSRPNCRFIHGSKEDEDGYKKTGELPPRLRQKVA
AGLGLSPADLPNGKEEVPICRDFLKGDCQRGAKCKFRHLQRDFEFDARGGGGTGGGSTGS
VLPGRRHDLYDIYDLPDRGFEDHEPGPKRRRGGCCPPDGPHFESYEYSLAPPRGVECRLL
EEENAMLRKRVEELKKQVSNLLATNEVLLEQNAQFRNQAKVITLSSTAPATEQTLAPTVG
TVATFNHGIAQTHTTLSSQALQPRPVSQQELVAPAGAPAAPPTNAAPPAAPPPPPPHLTP
EITPLSAALAQTIAQGMAPPPVSMAPVAVSVAPVAPVAVSMAQPLAGITMSHTTTPMVTY
PIASQSMRITAMPH
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgcctgaccgggacagctatgccaacggtaccgggagcagcggtggaggccctggaggt
ggtggcagcgaggaggccagtggggcaggggtaggcagtggcggggccagctcagatgcc
atctgtagagacttcttgaggaatgtgtgcaagcgaggcaagcgttgccgatatcgccac
ccagacatgagcgaggtgtccaacttgggggtgagcaaaaacgagttcatcttctgccat
gacttccagaacaaggagtgtagccgcccaaattgccgtttcatccatggctccaaggag
gatgaggatggctataagaagacaggagagcttcccccacggctgaggcagaaagtagca
gctggccttggcctttcaccggctgacctaccaaatggcaaggaggaggtccctatctgc
cgtgactttctcaagggtgactgtcagagaggagccaagtgcaagttccgtcacctgcaa
cgggattttgagtttgatgctcggggtggaggaggcactggtgggggctcaacaggctca
gtcctcccaggacgacgtcatgatctctatgatatctatgaccttcctgacaggggcttt
gaggaccatgagccaggcccaaaacgccggcgaggtggatgctgcccccctgatggccct
cattttgagtcatatgaatatagtttggctccaccgcgaggggtggagtgcagactgcta
gaggaggagaatgccatgctcaggaagcgggtagaggagttaaagaagcaggtcagcaac
ctgctggccaccaatgaggtactactggaacaaaatgctcagttccgcaatcaggccaag
gtcataaccctgagctccactgcaccagcgactgagcagactctggcccccactgtgggc
actgttgccacttttaaccatggcattgcccagactcacactactctcagcagccaggct
ctacagcctcgtccagtgtcccagcaagaactggtggcccctgctggagctccagctgct
cccccaactaatgctgcacctcctgctgctccaccacccccacccccacacttgacccca
gagatcacgccactgtcagctgccctggctcaaacaattgcccagggaatggcacctcca
cctgtctccatggctcctgtggctgtatctgtggctcctgtggcccctgtggctgtatcg
atggcccaacccttggcaggaatcacaatgagccacaccaccactcccatggtgacttac
cctatcgcttcccagagcatgcgcatcacggccatgccacactga

DBGET integrated database retrieval system