KEGG   Homo sapiens (human): 84883
Entry
84883             CDS       T01001                                 

Gene name
AIFM2, AMID, FSP1, PRG3
Definition
(RefSeq) apoptosis inducing factor mitochondria associated 2
  KO
K22745  apoptosis-inducing factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    84883 (AIFM2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO K_oxygenase GIDA NAD_binding_8 Thi4 FAD_binding_2 Trp_halogenase Lycopene_cycl AlaDh_PNT_C HI0933_like FAD_oxidored PaaX FAD_binding_3
Other DBs
NCBI-GeneID: 84883
NCBI-ProteinID: NP_001185625
OMIM: 605159
HGNC: 21411
Ensembl: ENSG00000042286
Vega: OTTHUMG00000018398
Pharos: Q9BRQ8(Tbio)
UniProt: Q9BRQ8
Position
10q22.1
AA seq 373 aa
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETG
FAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFN
EVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALA
DKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVI
LCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGL
HANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLF
VSTSWKTMRQSPP
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggggtcccaggtctcggtggaatcgggagctctgcacgtggtgattgtgggtgggggc
tttggcgggatcgcagcagccagccagctgcaggccctgaacgtccccttcatgctggtg
gacatgaaggactccttccaccacaatgtggctgctctccgagcctccgtggagacaggg
ttcgccaaaaagacattcatttcttactcggtgactttcaaggacaacttccggcagggg
ctagtagtggggatagacctgaagaaccagatggtgctgctgcagggtggcgaggccctg
cccttctctcatcttatcctggccacgggcagcactgggcccttcccgggcaagtttaat
gaggtttccagccagcaggccgctatccaggcctatgaggacatggtgaggcaggtccag
cgctcacggttcatcgtggtggtgggaggaggctcggctggagtggagatggcagcagag
attaaaacagaatatcctgagaaagaggtcactctcattcactcccaagtggccctggct
gacaaggagctcctgccctccgtccggcaggaagtgaaggagatcctcctccggaagggc
gtgcagctgctgctgagtgagcgggtgagcaatctggaggagctgcctctcaatgagtat
cgagagtacatcaaagtgcagacggacaaaggcacagaggtggccaccaacctggtgatt
ctctgcaccggcatcaagatcaacagctccgcctaccgcaaagcgtttgagagcagacta
gccagcagtggtgctctgagagtgaacgagcacctccaggtggagggccacagcaacgtc
tacgccattggtgactgtgccgacgtgaggacgcccaagatggcctatcttgccggcctc
cacgccaacatcgccgtggccaacatcgtcaactctgtgaagcagcggcctctccaggcc
tacaagccgggtgcactgacgttcctcctgtccatggggagaaatgacggtgtgggccaa
atcagtggcttctatgtgggccggctcatggttcggctgaccaagagccgggacctgttc
gtctctacgagctggaaaaccatgaggcagtctccaccttga

DBGET integrated database retrieval system