KEGG   Homo sapiens (human): 84886
Entry
84886             CDS       T01001                                 

Gene name
C1orf198
Definition
(RefSeq) chromosome 1 open reading frame 198
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4706
Other DBs
NCBI-GeneID: 84886
NCBI-ProteinID: NP_116189
HGNC: 25900
Ensembl: ENSG00000119280
Vega: OTTHUMG00000037790
Pharos: Q9H425(Tdark)
UniProt: Q9H425 A1NYL2
Position
1q42.2
AA seq 327 aa
MASMAAAIAASRSAVMSGNRPLDDRERKRFTYFSSLSPMARKIMQDKEKIREKYGPEWAR
LPPAQQDEIIDRCLVGPRAPAPRDPGDSEELTRFPGLRGPTGQKVVRFGDEDLTWQDEHS
APFSWETKSQMEFSISALSIQEPSNGTAASEPRPLSKASQGSQALKSSQGSRSSSLDALG
PTRKEEEASFWKINAERSRGEGPEAEFQSLTPSQIKSMEKGEKVLPPCYRQEPAPKDREA
KVERPSTLRQEQRPLPNVSTERERPQPVQAFSSALHEAAPSQLEGKLPSPDVRQDDGEDT
LFSEPKFAQVSSSNVVLKTGFDFLDNW
NT seq 984 nt   +upstreamnt  +downstreamnt
atggcgtccatggcggcggcgatcgcggcttcgcgctcggcggtcatgagcgggaaccgg
cctctggacgaccgggagcgaaagcgcttcacttacttctcgtcgctgagccccatggcc
aggaagatcatgcaggacaaggagaagatccgcgagaagtacgggcccgagtgggcgcgg
ctgccgcccgcgcagcaggacgagatcatcgaccggtgcctggtggggccgcgcgccccg
gcgccccgagaccccggggactcggaggagctcacgcgcttccccggcttgcgcgggccc
acgggccagaaggtggtgcgcttcggggacgaggatctaacttggcaagatgagcactct
gcccctttctcctgggaaacaaagagtcagatggagttcagtatctccgccctatccatc
caggagccgagcaacggcaccgccgccagcgagcccagaccactgtccaaagcttcccag
ggctcccaggccctcaagtcctcccaaggcagcaggtcctccagcctggacgccctgggc
cccaccaggaaggaggaggaagcgtcattctggaagatcaatgctgagcggtcccgaggg
gaggggcctgaggccgagttccagtcgctgacccctagccagatcaagtccatggagaag
ggggaaaaggtcttgcctccctgctaccggcaggaacctgccccgaaggacagggaggcc
aaggtggaaaggcccagcaccctccgtcaggagcagcgtcctcttcccaacgtgagcacc
gaacgtgagagaccccagcctgtccaggccttcagcagtgcactgcacgaggctgccccc
tcccagctcgaggggaagctgccatctcctgatgtcaggcaggacgatggggaagacacc
ctgttctcggaacccaagtttgcacaggtcagctcaagtaatgtcgtcttgaagacggga
tttgattttctggacaattggtaa

DBGET integrated database retrieval system