KEGG   Homo sapiens (human): 84889
Entry
84889             CDS       T01001                                 

Gene name
SLC7A3, ATRC3, CAT-3, CAT3
Definition
(RefSeq) solute carrier family 7 member 3
  KO
K13865  solute carrier family 7 (cationic amino acid transporter), member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    84889 (SLC7A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   84889 (SLC7A3)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C O-antigen_lig
Other DBs
NCBI-GeneID: 84889
NCBI-ProteinID: NP_001041629
OMIM: 300443
HGNC: 11061
Ensembl: ENSG00000165349
Vega: OTTHUMG00000021780
Pharos: Q8WY07(Tbio)
UniProt: Q8WY07
Position
Xq13.1
AA seq 619 aa
MPWQAFRRFGQKLVRRRTLESGMAETRLARCLSTLDLVALGVGSTLGAGVYVLAGEVAKD
KAGPSIVICFLVAALSSVLAGLCYAEFGARVPRSGSAYLYSYVTVGELWAFTTGWNLILS
YVIGTASVARAWSSAFDNLIGNHISKTLQGSIALHVPHVLAEYPDFFALGLVLLLTGLLA
LGASESALVTKVFTGVNLLVLGFVMISGFVKGDVHNWKLTEEDYELAMAELNDTYSLGPL
GSGGFVPFGFEGILRGAATCFYAFVGFDCIATTGEEAQNPQRSIPMGIVISLSVCFLAYF
AVSSALTLMMPYYQLQPESPLPEAFLYIGWAPARYVVAVGSLCALSTSLLGSMFPMPRVI
YAMAEDGLLFRVLARIHTGTRTPIIATVVSGIIAAFMAFLFKLTDLVDLMSIGTLLAYSL
VSICVLILRYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQIVYVC
SSLLAVLLTALCLVLAQWSVPLLSGDLLWTAVVVLLLLLIIGIIVVIWRQPQSSTPLHFK
VPALPLLPLMSIFVNIYLMMQMTAGTWARFGVWMLIGFAIYFGYGIQHSLEEIKSNQPSR
KSRAKTVDLDPGTLYVHSV
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgccgtggcaagcatttcgcagatttggtcaaaagctggtacgcagacgtacactggag
tcaggcatggctgagactcgccttgccagatgcctaagcaccctggatttagtggccctg
ggtgtgggcagcacattgggtgcaggcgtgtatgtcctagctggcgaggtggccaaagat
aaagcagggccatccattgtgatctgctttttggtggctgccctgtcttctgtgttggct
gggctgtgctatgcggagtttggtgcccgggttccccgttctggttcggcatatctctac
agctatgtcactgtgggtgaactctgggccttcaccactggctggaacctcatcctctcc
tatgtcattggtacagccagtgtggcccgggcctggagctctgcttttgacaacctgatt
gggaaccacatctctaagactctgcaggggtccattgcactgcacgtgccccatgtcctt
gcagaatatccagatttctttgctttgggcctcgtgttgctgctcactggattgttggct
ctcggggctagtgagtcggccctggttaccaaagtgttcacaggcgtgaaccttttggtt
cttgggttcgtcatgatctctggcttcgttaagggggacgtgcacaactggaagctcaca
gaagaggactacgaattggccatggctgaactcaatgacacctatagcttgggtcctctg
ggctctggaggatttgtgcctttcggcttcgagggaattctccgtggagcagcgacctgt
ttctatgcatttgttggtttcgactgtattgctaccactggagaagaagcccagaatccc
cagcgttccatcccgatgggcattgtgatctcactgtctgtctgctttttggcgtatttt
gctgtctcttctgcactcaccctgatgatgccttactaccagcttcagcctgagagccct
ttgcctgaggcatttctctacattggatgggctcctgcccgctatgttgtggctgttggc
tccctctgtgctctttctaccagcctcctgggctccatgttccccatgcctcgggtgatc
tacgcgatggcagaggatggcctcctgttccgtgtacttgctcggatccacaccggcaca
cgcaccccaatcatagccaccgtggtctctggcattattgcagcattcatggcattcctc
ttcaaactcactgatcttgtggacctcatgtcaattgggaccctgcttgcttactccctg
gtgtcgatttgtgttctcatcctcaggtatcaacctgatcaggagacaaagactggggaa
gaagtggagttgcaggaggaggcaataactactgaatcagagaagttgaccctatgggga
ctatttttcccactcaactccatccccactccactctctggccaaattgtctatgtttgt
tcctcattgcttgctgtcctgctgactgctctttgcctggtgctggcccagtggtcagtt
ccattgctttctggagacctgctgtggactgcagtggttgtgctgctcctgctgctcatt
attgggatcattgtggtcatctggagacagccacagagttccactccccttcactttaag
gtgcctgctttgcctctcctcccactaatgagcatctttgtgaatatttaccttatgatg
cagatgacagctggtacctgggcccgatttggggtctggatgctgattggctttgctatc
tacttcggctatgggatccagcacagcctggaagagattaagagtaaccaaccctcacgc
aagtctagagccaaaactgtagaccttgatcccggcactctctatgtccactcagtttga

DBGET integrated database retrieval system