KEGG   Homo sapiens (human): 84894Help
Entry
84894             CDS       T01001                                 

Gene name
LINGO1, LERN1, LRRN6A, MRT64, UNQ201
Definition
(RefSeq) leucine rich repeat and Ig domain containing 1
  KO
K23533  leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84894 (LINGO1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    84894 (LINGO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 Ig_2 LRR_9 ig LRRNT V-set
Motif
Other DBs
NCBI-GeneID: 84894
NCBI-ProteinID: NP_116197
OMIM: 609791
HGNC: 21205
Ensembl: ENSG00000169783
Vega: OTTHUMG00000172629
Pharos: Q96FE5(Tbio)
UniProt: Q96FE5
Structure
PDB: 

Position
15q24.3
AA seq 620 aa AA seqDB search
MQVSKRMLAGGVRSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRK
RFVAVPEGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFN
LRTLGLRSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLV
YISHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYR
LKVLEISHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPIS
TIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESVFHSVGN
LETLILDSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFT
CRRARIRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDG
TLEVRYAQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGE
ANSTRATVPFPFDIKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPR
KSDAGISSADAPRKFNMKMI
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgagcaagaggatgctggcggggggcgtgaggagcatgcccagccccctcctg
gcctgctggcagcccatcctcctgctggtgctgggctcagtgctgtcaggctcggccacg
ggctgcccgccccgctgcgagtgctccgcccaggaccgcgctgtgctgtgccaccgcaag
cgctttgtggcagtccccgagggcatccccaccgagacgcgcctgctggacctaggcaag
aaccgcatcaaaacgctcaaccaggacgagttcgccagcttcccgcacctggaggagctg
gagctcaacgagaacatcgtgagcgccgtggagcccggcgccttcaacaacctcttcaac
ctccggacgctgggtctccgcagcaaccgcctgaagctcatcccgctaggcgtcttcact
ggcctcagcaacctgaccaagctggacatcagcgagaacaagatcgttatcctactggac
tacatgtttcaggacctgtacaacctcaagtcactggaggttggcgacaatgacctcgtc
tacatctctcaccgcgccttcagcggcctcaacagcctggagcagctgacgctggagaaa
tgcaacctgacctccatccccaccgaggcgctgtcccacctgcacggcctcatcgtcctg
aggctccggcacctcaacatcaatgccatccgggactactccttcaagaggctgtaccga
ctcaaggtcttggagatctcccactggccctacttggacaccatgacacccaactgcctc
tacggcctcaacctgacgtccctgtccatcacacactgcaatctgaccgctgtgccctac
ctggccgtccgccacctagtctatctccgcttcctcaacctctcctacaaccccatcagc
accattgagggctccatgttgcatgagctgctccggctgcaggagatccagctggtgggc
gggcagctggccgtggtggagccctatgccttccgcggcctcaactacctgcgcgtgctc
aatgtctctggcaaccagctgaccacactggaggaatcagtcttccactcggtgggcaac
ctggagacactcatcctggactccaacccgctggcctgcgactgtcggctcctgtgggtg
ttccggcgccgctggcggctcaacttcaaccggcagcagcccacgtgcgccacgcccgag
tttgtccagggcaaggagttcaaggacttccctgatgtgctactgcccaactacttcacc
tgccgccgcgcccgcatccgggaccgcaaggcccagcaggtgtttgtggacgagggccac
acggtgcagtttgtgtgccgggccgatggcgacccgccgcccgccatcctctggctctca
ccccgaaagcacctggtctcagccaagagcaatgggcggctcacagtcttccctgatggc
acgctggaggtgcgctacgcccaggtacaggacaacggcacgtacctgtgcatcgcggcc
aacgcgggcggcaacgactccatgcccgcccacctgcatgtgcgcagctactcgcccgac
tggccccatcagcccaacaagaccttcgctttcatctccaaccagccgggcgagggagag
gccaacagcacccgcgccactgtgcctttccccttcgacatcaagaccctcatcatcgcc
accaccatgggcttcatctctttcctgggcgtcgtcctcttctgcctggtgctgctgttt
ctctggagccggggcaagggcaacacaaagcacaacatcgagatcgagtatgtgccccga
aagtcggacgcaggcatcagctccgccgacgcgccccgcaagttcaacatgaagatgata
tga

DBGET integrated database retrieval system