KEGG   Homo sapiens (human): 84897
Entry
84897             CDS       T01001                                 

Gene name
TBRG1, NIAM, TB-5
Definition
(RefSeq) transforming growth factor beta regulator 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FYRN FYRC DUF1633
Other DBs
NCBI-GeneID: 84897
NCBI-ProteinID: NP_116200
OMIM: 610614
HGNC: 29551
Ensembl: ENSG00000154144
Vega: OTTHUMG00000153024
Pharos: Q3YBR2(Tbio)
UniProt: Q3YBR2
Structure
PDB: 
2WZO

Position
11q24.2
AA seq 411 aa
MSLLDGLASSPRAPLQSSKARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIA
RLEEKFLKAKEERRYLLKKLLQLQALTEGEVQAAAPSHSSSLPLTYGVASSVGTIQGAGP
ISGPSTGAEEPFGKKTKKEKKEKGKENNKLEVLKKTCKKKKMAGGARKLVQPIALDPSGR
PVFPIGLGGLTVYSLGEIITDRPGFHDESAIYPVGYCSTRIYASMKCPDQKCLYTCQIKD
GGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTISTTMGKLMPNLLPAGADFFGFSHPA
IHNLIQSCPGARKCINYQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQRQIFDEDQNDP
LLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSPSQGSPIQSSD
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgagcctgctggacggcctcgcttcctcgccgcgggctccgctgcagtccagcaaggcc
aggatgaaaaagctcccgaagaagagccagaatgagaagtaccggctgaagtacctgcgg
ctgcgcaaagcggccaaggccacggtgtttgaaaatgctgctatttgtgatgaaattgct
cgtcttgaggaaaaatttcttaaagcaaaagaagaaagaaggtacttgctaaagaagctc
ctccagcttcaggctctaactgaaggggaagtacaggctgcagctccttcccacagttcc
agtttgcccctgacttatggtgtggccagctctgtgggaactatacagggagctgggcct
atttcagggcccagcactggggctgaggaaccatttgggaagaaaactaagaaggagaaa
aaagaaaaaggcaaagagaacaacaaactggaagttctgaagaaaacatgcaagaaaaag
aaaatggcgggaggtgctcgcaagctggttcagcccattgccctggatccctcaggacgg
cctgtgttccccatcggactagggggtctaacagtatatagcctgggggagatcatcacc
gaccgacctggctttcatgatgagagtgccatctaccccgtgggctattgcagtactcga
atatatgccagcatgaagtgcccagaccagaagtgtctatatacctgtcagatcaaggat
ggtggtgtgcagcctcagtttgaaattgttcctgaagatgacccccagaatgccattgtc
agctcttctgcagatgcttgtcatgcagaactgctcaggactataagcactactatgggg
aaactaatgcctaacctgcttccagctggagctgacttttttggattttctcatccagcc
atccacaacctgatccagagctgtccaggagctcgaaaatgcatcaattaccagtgggtg
aaatttgatgtgtgcaaacctggagatgggcagctacctgaggggctgccggagaatgat
gcagctatgagctttgaagcctttcagagacagatctttgatgaagatcagaatgatccc
cttctgccaggatccttggacctcccagagcttcagcctgcagcctttgtgtcttcttac
cagcccatgtacctgacacatgaacccttggtagatactcacctgcagcacttgaagtct
ccatcacagggtagcccaattcagtcttcagattga

DBGET integrated database retrieval system