KEGG   Homo sapiens (human): 8490Help
Entry
8490              CDS       T01001                                 

Gene name
RGS5, MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129
Definition
(RefSeq) regulator of G protein signaling 5
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    8490 (RGS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS HalX
Motif
Other DBs
NCBI-GeneID: 8490
NCBI-ProteinID: NP_003608
OMIM: 603276
HGNC: 10001
Ensembl: ENSG00000143248 ENSG00000232995
Vega: OTTHUMG00000034441
Pharos: O15539(Tbio)
UniProt: O15539 A0A024R8X9
Structure
PDB: 

Position
1q23.3
AA seq 181 aa AA seqDB search
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQ
WRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEF
IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELI
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaaggacttgcagctttgccccactcatgcctggaaagggccaaggagattaag
atcaagttgggaattctcctccagaagccagactcagttggtgaccttgtcattccgtac
aatgagaagccagagaaaccagccaagacccagaaaacctcgctggacgaggccctgcag
tggcgtgattccctggacaaactcctgcagaacaactatggacttgccagtttcaaaagt
ttcctgaagtctgaattcagtgaggaaaaccttgagttctggattgcctgtgaggattac
aagaagatcaagtcccctgccaagatggctgagaaggcaaagcaaatttatgaagaattc
attcaaacggaggctcctaaagaggtgaatattgaccacttcactaaggacatcacaatg
aagaacctggtggaaccttccctgagcagctttgacatggcccagaaaagaatccatgcc
ctgatggaaaaggattctctgcctcgctttgtgcgctctgagttttatcaggagttaatc
aagtag

DBGET integrated database retrieval system