KEGG   Homo sapiens (human): 84901
Entry
84901             CDS       T01001                                 
Symbol
NFATC2IP, ESC2, NIP45, RAD60
Name
(RefSeq) nuclear factor of activated T cells 2 interacting protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Rad60-SLD ubiquitin
Other DBs
NCBI-GeneID: 84901
NCBI-ProteinID: NP_116204
OMIM: 614525
HGNC: 25906
Ensembl: ENSG00000176953
UniProt: Q8NCF5
Position
16:28950937..28967092
AA seq 419 aa
MAEPVGKRGRWSGGSGAGRGGRGGWGGRGRRPRAQRSPSRGTLDVVSVDLVTDSDEEILE
VATARGAADEVEVEPPEPPGPVASRDNSNSDSEGEDRRPAGPPREPVRRRRRLVLDPGEA
PLVPVYSGKVKSSLRLIPDDLSLLKLYPPGDEEEAELADSSGLYHEGSPSPGSPWKTKLR
TKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQG
QEQQGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVS
PSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQT
LEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcggagcctgtggggaagcggggccgctggtccggaggtagcggtgccggccgaggg
ggtcggggcggctggggcggtcggggccggcgtcctcgggcccagcggtctccatcccgg
ggcacgctggacgtagtgtctgtggacttggtcaccgacagcgatgaggaaattctggag
gtcgccaccgctcgcggtgccgcggacgaggttgaggtggagcccccggagcccccgggg
ccggtcgcgtcccgggataacagcaacagtgacagcgaaggggaggacaggcggcccgca
ggacccccgcgggagccggtcaggcggcggcggcggctggtgctggatccgggggaggcg
ccgctggttccggtgtactcggggaaggttaaaagcagccttcgccttatcccagatgat
ctatccctcctgaaactctaccctccaggggatgaggaagaggcagagctggcagattcg
agtggtctctaccatgagggctccccatcaccaggctctccctggaagacaaagctgagg
actaaggataaagaagagaagaaaaagacagagtttctggatctggacaactctcctctg
tccccaccttcaccaaggaccaaaagcagaacgcatactcgggcactcaagaagttaagt
gaggtgaacaagcgcctccaggatctccgttcctgtctgagccccaagccacctcagggt
caagagcaacagggccaagaggatgaagtggtcttggtggaagggcccaccctcccagag
accccccgactcttcccactcaaaatccgttgccgggctgacctggtcagattgcccctc
aggatgtcggagcccctgcagagtgtggtggaccacatggccacccaccttggggtgtcc
ccaagcaggatccttttgctttttggagagacagagctatcacctactgccactcccagg
accctaaagctcggagtggctgacatcattgactgtgtggtactaacaagttctccagag
gccacagagacgtcccaacagctccagctccgggtgcagggaaaggagaaacaccagaca
ctggaagtctcactgtctcgagattcccctctaaagaccctcatgtcccactatgaggag
gccatgggactgtcgggacggaagctctccttcttctttgatgggacaaagctttcaggc
agggagctgccagctgacctgggcatggaatctggggacctcattgaggtctggggctga

DBGET integrated database retrieval system