KEGG   Homo sapiens (human): 8491Help
Entry
8491              CDS       T01001                                 

Gene name
MAP4K3, GLK, MAPKKKK3, MEKKK_3, MEKKK3, RAB8IPL1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 3
  KO
K04406  mitogen-activated protein kinase kinase kinase kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8491 (MAP4K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8491 (MAP4K3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8491 (MAP4K3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   8491 (MAP4K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNH Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 8491
NCBI-ProteinID: NP_003609
OMIM: 604921
HGNC: 6865
Ensembl: ENSG00000011566
Vega: OTTHUMG00000102127
Pharos: Q8IVH8(Tchem)
UniProt: Q8IVH8 B3KMM5 A8K602
Structure
PDB: 

Position
2p22.1
AA seq 894 aa AA seqDB search
MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQ
EIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRET
LQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAP
EVAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKM
KWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQHLTRSLAIELLDKVNNPDHSTYHDF
DDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHHELPDSDGFLD
SSEEIYYTARSNLDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDD
ESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPP
PRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGLPPTP
KVHMGACFSKVFNGCPLKIHCASSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLF
PRRCTWLYVMNNCLLSISGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKF
SVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIDFPIPC
PLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDTPQTNVTHVT
QLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQG
RSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccggcttcgatttgtcccgccggaacccgcaggaggacttcgagctgattcag
cgcatcggcagcggcacctacggcgacgtctacaaggcacggaatgttaacactggtgaa
ttagcagcaattaaagtaataaaattggaaccaggagaagactttgcagttgtgcagcaa
gaaattattatgatgaaagactgtaaacacccaaatattgttgcttattttggaagctat
ctcaggcgagataagctttggatttgcatggagttttgtggaggtggttctttacaggat
atttatcacgtaactggacctctgtcagaactgcaaattgcatatgttagcagagaaaca
ctgcagggattatattatcttcacagtaaaggaaaaatgcacagagatataaagggagct
aacattctattaacggataatggtcatgtgaaattggctgattttggagtatctgcacag
ataacagctacaattgccaaacggaagtctttcattggcacaccatattggatggctcca
gaagttgcagctgttgagaggaaggggggttacaatcaactctgtgatctctgggcagtg
ggaatcactgccatagaacttgcagagcttcagcctcctatgtttgacttacacccaatg
agagcattatttctaatgacaaaaagcaattttcagcctcctaaactaaaggataaaatg
aaatggtcaaatagttttcatcactttgtgaaaatggcacttaccaaaaatccgaaaaaa
agacctactgctgaaaaattattacagcatccttttgtaacacaacatttgacacggtct
ttggcaatcgagctgttggataaagtaaataatccagatcattccacttaccatgatttc
gatgatgatgatcctgagcctcttgttgctgtaccacatagaattcactcaacaagtaga
aacgtgagagaagaaaaaacacgctcagagataacctttggccaagtgaaatttgatcca
cccttaagaaaggagacagaaccacatcatgaacttcccgacagtgatggttttttggac
agttcagaagaaatatactacactgcaagatctaatctggatctgcaactggaatatgga
caaggacaccaaggtggttactttttaggtgcaaacaagagtcttctcaagtctgttgaa
gaagaattgcatcagcgaggacacgtcgcacatttagaagatgatgaaggagatgatgat
gaatctaaacactcaactctgaaagcaaaaattccacctcctttgccaccaaagcctaag
tctatcttcataccacaggaaatgcattctactgaggatgaaaatcaaggaacaatcaag
agatgtcccatgtcagggagcccagcaaagccatcccaagttccacctagaccaccacct
cccagattacccccacacaaacctgttgccttaggaaatggaatgagctccttccagtta
aatggtgaacgagatggctcattatgtcaacaacagaatgaacatagaggcacaaacctt
tcaagaaaagaaaagaaagatgtaccaaagcctattagtaatggtcttcctccaacacct
aaagtgcatatgggtgcatgtttttcaaaagtttttaatgggtgtcccttgaaaattcac
tgtgcatcatcatggataaacccagatacaagagatcagtacttgatatttggtgccgaa
gaagggatttataccctcaatcttaatgaacttcatgaaacatcaatggaacagctattc
cctcgaaggtgtacatggttgtatgtaatgaacaattgcttgctatcaatatctggtaaa
gcttctcagctttattcccataatttaccagggctttttgattatgcaagacaaatgcaa
aagttacctgttgctattccagcacacaaactccctgacagaatactgccaaggaaattt
tctgtatcagcaaaaatccctgaaaccaaatggtgccagaagtgttgtgttgtaagaaat
ccttacacgggccataaatacctatgtggagcacttcagactagcattgttctattagaa
tgggttgaaccaatgcagaaatttatgttaattaagcacatagattttcctataccatgt
ccacttagaatgtttgaaatgctggtagttcctgaacaggagtaccctttagtttgtgtt
ggtgtcagtagaggtagagacttcaaccaagtggttcgatttgagacggtcaatccaaat
tctacctcttcatggtttacagaatcagataccccacagacaaatgttactcatgtaacc
caactggagagagataccatccttgtatgcttggactgttgtataaaaatagtaaatctc
caaggaagattaaaatctagcaggaaattgtcatcagaactcacctttgatttccagatt
gaatcaatagtgtgcctacaagacagtgtgctagctttctggaaacatggaatgcaaggt
agaagttttagatctaatgaggtaacacaagaaatttcagatagcacaagaattttcagg
ctgcttggatctgacagggtcgtggttttggaaagtaggccaactgataaccccacagca
aatagcaatttgtacatcctggcgggtcatgaaaacagttactga

DBGET integrated database retrieval system