KEGG   Homo sapiens (human): 84912
Entry
84912             CDS       T01001                                 
Symbol
SLC35B4, YEA, YEA4
Name
(RefSeq) solute carrier family 35 member B4
  KO
K15278  solute carrier family 35 (UDP-xylose/UDP-N-acetylglucosamine transporter), member B4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    84912 (SLC35B4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   84912 (SLC35B4)
SSDB
Motif
Pfam: UAA TPT
Other DBs
NCBI-GeneID: 84912
NCBI-ProteinID: NP_116215
OMIM: 610923
HGNC: 20584
Ensembl: ENSG00000205060
Pharos: Q969S0(Tbio)
UniProt: Q969S0
Position
7:complement(134289332..134320338)
AA seq 331 aa
MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPA
IPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFK
YTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIF
QETLYKRFGKHSKEALFYNHALPLPGFVFLASDIYDHAVLFNKSELYEIPVIGVTLPIMW
FYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVSLIFSILYFQNPFTLWHWLGT
LFVFIGTLMYTEVWNNLGTTKSEPQKDSKKN
NT seq 996 nt   +upstreamnt  +downstreamnt
atgcgcccggccttggcggtgggcctggtgttcgcaggctgctgcagtaacgtgatcttc
ctagagctcctggcccggaagcatccaggatgtgggaacattgtgacatttgcacaattt
ttatttattgctgtggaaggcttcctctttgaagctgatttgggaaggaagccaccagct
atcccaataaggtactatgccataatggtgaccatgttcttcaccgtgagcgtggtgaac
aactatgccctgaatctcaacattgccatgcccctgcatatgatatttagatccggttct
ctaattgccaacatgattctaggaattatcattttgaagaaaagatacagtatattcaaa
tatacctccattgccctggtgtctgtggggatatttatttgcacttttatgtcagcaaag
caggtgacttcccagtccagcttgagtgagaatgatggattccaggcatttgtgtggtgg
ttactaggtattggggcattgacttttgctcttctgatgtcagcaaggatggggatattc
caagagactctctacaaacgatttgggaaacactccaaggaggctttgttttataatcac
gcccttccacttccgggtttcgtcttcttggcttctgatatttatgaccatgcagttcta
ttcaataagtctgagttatatgaaattcccgtcatcggagtgaccctgcccatcatgtgg
ttctacctcctcatgaacatcatcactcagtacgtgtgcatccggggtgtgtttatcctc
accacagaatgcgcctccctcaccgtcacgctcgtcgtgaccctacgcaaatttgtgagc
ctcatcttttccatcttgtacttccagaaccccttcaccctgtggcactggctgggcacc
ttgtttgtcttcattgggaccttaatgtacacagaggtgtggaacaacctagggaccaca
aaaagtgagcctcagaaggacagcaagaagaactga

DBGET integrated database retrieval system