KEGG   Homo sapiens (human): 84916
Entry
84916             CDS       T01001                                 
Symbol
UTP4, CIRH1A, CIRHIN, NAIC, TEX292
Name
(RefSeq) UTP4 small subunit processome component
  KO
K14548  U3 small nucleolar RNA-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Disease
H02194  North American Indian childhood cirrhosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    84916 (UTP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    84916 (UTP4)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    84916 (UTP4)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 Ge1_WD40 Frtz CPSF_A PQQ_2
Other DBs
NCBI-GeneID: 84916
NCBI-ProteinID: NP_116219
OMIM: 607456
HGNC: 1983
Ensembl: ENSG00000141076
Pharos: Q969X6(Tbio)
UniProt: Q969X6
Structure
Position
16:69132649..69169021
AA seq 686 aa
MGEFKVHRVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHES
RATEALCWAEGQRLFSAGLNGEIMEYDLQALNIKYAMDAFGGPIWSMAASPSGSQLLVGC
EDGSVKLFQITPDKIQFERNFDRQKSRILSLSWHPSGTHIAAGSIDYISVFDVKSGSAVH
KMIVDRQYMGVSKRKCIVWGVAFLSDGTIISVDSAGKVQFWDSATGTLVKSHLIANADVQ
SIAVADQEDSFVVGTAEGTVFHFQLVPVTSNSSEKQWVRTKPFQHHTHDVRTVAHSPTAL
ISGGTDTHLVFRPLMEKVEVKNYDAALRKITFPHRCLISCSKKRQLLLFQFAHHLELWRL
GSTVATGKNGDTLPLSKNADHLLHLKTKGPENIICSCISPCGSWIAYSTVSRFFLYRLNY
EHDNISLKRVSKMPAFLRSALQILFSEDSTKLFVASNQGALHIVQLSGGSFKHLHAFQPQ
SGTVEAMCLLAVSPDGNWLAASGTSAGVHVYNVKQLKLHCTVPAYNFPVTAMAIAPNTNN
LVIAHSDQQVFEYSIPDKQYTDWSRTVQKQGFHHLWLQRDTPITHISFHPKRPMHILLHD
AYMFCIIDKSLPLPNDKTLLYNPFPPTNESDVIRRRTAHAFKISKIYKPLLFMDLLDERT
LVAVERPLDDIIAQLPPPIKKKKFGT
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgggtgaatttaaggtccatcgagtacgtttctttaattatgttccatcaggaatccgc
tgtgtggcttacaataaccagtcaaacagattggctgtttcacgaacagatggcactgtg
gaaatttataacttgtcagcaaactactttcaggagaaatttttcccaggtcatgagtct
cgggctacagaagctttgtgctgggcagaaggacagcgactctttagtgctgggctcaat
ggcgagattatggagtatgatttacaggcgttaaacatcaagtatgctatggatgccttt
ggaggacctatttggagcatggctgccagccccagtggctctcaacttttggttggttgt
gaagatggatctgtgaaactatttcaaattaccccagacaaaatccagtttgaaagaaat
tttgatcggcagaaaagtcgcatcctgagtctcagctggcatccctctggtacccacatt
gcagctggttccatagactacattagtgtgtttgatgtcaaatcaggcagcgctgttcat
aagatgattgtggacaggcagtatatgggcgtgtctaagcggaagtgcatcgtgtggggt
gtcgccttcttgtccgatggcactatcataagtgtggactctgctgggaaggtgcagttc
tgggactcagccactgggacgcttgtgaagagccatctcatcgctaatgctgacgtgcag
tccattgctgtagctgaccaagaagacagtttcgtggtgggcacagccgagggaacagtc
ttccattttcagctggtccctgtgacatctaacagcagtgagaagcagtgggtgcggaca
aaaccgttccagcatcacactcatgacgtgcgcactgtggcccacagcccaacagcgctg
atatctggaggcactgacacccacttagtctttcgtcctctcatggagaaggtggaagta
aagaattacgatgccgctctccgaaaaatcacctttccccaccgatgtctcatctcctgt
tctaaaaagaggcagcttctcctcttccagtttgctcatcacttagaactttggcgactg
ggatccacagttgcaacaggcaagaatggggatactcttccactctctaaaaatgcagat
catttactgcacctaaagacaaagggtcctgagaacattatctgtagctgtatctcccca
tgtggaagttggatagcctattctacagtttctcggttttttctctatcggctgaattat
gaacatgacaacataagcctcaaaagggtttccaaaatgccagcattccttcgctctgcc
cttcagattttgttttctgaagattcaacaaagctctttgtagcatcaaatcaaggagct
ctgcatattgttcagctgtcaggaggaagcttcaagcacctgcatgctttccagcctcag
tcaggaacagtggaggccatgtgtcttttggcagtcagtccagatgggaattggctagct
gcatcaggtaccagtgctggagtccatgtctacaacgtaaaacagctaaagcttcactgc
acggtgcctgcttacaatttcccagtgactgctatggctattgcccccaataccaacaac
cttgtcatcgctcattcggaccagcaggtatttgagtacagcatcccagacaaacagtat
acagattggagccggactgtccagaagcagggctttcaccacctttggctccaaagggat
actcctatcacacacatcagttttcatcccaagagaccgatgcacatccttctccatgat
gcctacatgttctgcatcattgacaagtcattgccccttccaaatgacaaaaccttactc
tacaatccatttcctcccacgaatgaatcagatgtcatccggaggcgcacagctcatgct
tttaaaatttctaagatatataagcctctactcttcatggatcttttggatgaaagaaca
ctcgtggcagtagaacggcctctggatgacatcattgctcagctcccaccacccattaaa
aagaagaaatttggaacctaa

DBGET integrated database retrieval system