KEGG   Homo sapiens (human): 84925
Entry
84925             CDS       T01001                                 
Symbol
SLC49A4, DIRC2, RCC4
Name
(RefSeq) solute carrier family 49 member 4
  KO
K15381  MFS transporter, FLVCR family, disrupted in renal carcinoma protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    84925 (SLC49A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC49: FLVCR-related transporter
   84925 (SLC49A4)
 Major facilitator superfamily (MFS)
  Protein transporters
   Feline leukemia virus subgroup C receptor (FLVCR) [TC:2.A.1.28]
    84925 (SLC49A4)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 84925
NCBI-ProteinID: NP_116228
OMIM: 602773
HGNC: 16628
Ensembl: ENSG00000138463
Pharos: Q96SL1(Tbio)
UniProt: Q96SL1
Position
3:122795069..122881139
AA seq 478 aa
MGSRWSSEEERQPLLGPGLGPGLGASWRSREAAAAALPAAVPGPGRVYGRRWLVLLLFSL
LAFVQGLVWNTWGPIQNSARQAYGFSSWDIALLVLWGPIGFLPCFAFMWLLDKRGLRITV
LLTSFLMVLGTGLRCIPISDLILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERA
TATAIASMLSYLGGACAFLVGPLVVPAPNGTSPLLAAESSRAHIKDRIEAVLYAEFGVVC
LIFSATLAYFPPRPPLPPSVAAASQRLSYRRSVCRLLSNFRFLMIALAYAIPLGVFAGWS
GVLDLILTPAHVSQVDAGWIGFWSIVGGCVVGIAMARFADFIRGMLKLILLLLFSGATLS
STWFTLTCLNSITHLPLTTVTLYASCILLGVFLNSSVPIFFELFVETVYPVPEGITCGVV
TFLSNMFMGVLLFFLTFYHTELSWFNWCLPGSCLLSLLLILCFRESYDRLYLDVVVSV
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgggctctcgctggagcagcgaagaggagaggcagccgctgctggggcccgggctcggg
cctgggctgggggcctcctggagaagccgggaggcggcggcggcggcgctgcccgcggcg
gtcccgggtcccgggcgggtatacgggcgccgctggctggtgctgctgctcttctcgctg
ctggcgttcgttcagggcctggtctggaacacctggggtcccatccagaactcggcgcgc
caggcctacggcttctccagctgggacatcgcgctgctcgtgctgtgggggcccatcggc
ttcctgccctgcttcgcgttcatgtggctcctggacaagagaggtctccggataactgtg
ctcctgacatccttccttatggttttgggaactggtctaagatgcatacctatatcagac
ttaatccttaaaagaagattaattcatggaggacagatgttaaatggattggcaggtcca
actgtaatgaatgcagcaccatttctctctacgacgtggttttctgcagatgaaagggcc
acagccacagctattgcatcaatgctcagttatcttgggggagcatgtgcatttttagtt
ggaccacttgttgttccagctcccaatgggacatcacctcttcttgctgcagagagcagc
agggcgcatattaaagatcgcatagaggctgtgttatatgcagaatttggagttgtctgc
ttaatattttctgcaacactagcttatttcccaccccgacctcctcttcctcccagtgtt
gctgcagctagccagcggctgagttatcggagaagcgtttgtagattattaagcaatttt
cgatttttgatgattgctttagcatatgccataccacttggtgtatttgctggctggtct
ggagttctggacttaattttaacaccagcgcatgtcagccaagtagatgctggctggatt
ggattttggtccatagttggaggctgtgttgttggaatagctatggcaaggtttgcagat
tttatcaggggtatgctgaaactaattcttctcctcctgttttcgggagctacactgtca
tccacgtggttcaccctgacctgtttgaacagcatcacacacctacctttaaccacagtg
acattgtatgcctcctgtattctcctgggagtgttcttgaatagcagcgtgcctatattt
tttgagctttttgtggaaactgtctacccagttccagaaggaattacttgtggagttgtc
acttttttaagtaatatgtttatgggagtacttttattttttctcacattttatcataca
gagttgtcttggttcaactggtgccttcccgggtcgtgtttgctcagtctcctcctcatt
ctgtgcttcagggaatcctatgacagactctatcttgatgtggttgtctccgtttaa

DBGET integrated database retrieval system