KEGG   Homo sapiens (human): 84932Help
Entry
84932             CDS       T01001                                 

Gene name
RAB2B
Definition
(RefSeq) RAB2B, member RAS oncogene family
  KO
K07878  Ras-related protein Rab-2B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84932 (RAB2B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    84932 (RAB2B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    84932 (RAB2B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    84932 (RAB2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3 AAA_24
Motif
Other DBs
NCBI-GeneID: 84932
NCBI-ProteinID: NP_116235
OMIM: 607466
HGNC: 20246
Ensembl: ENSG00000129472
Vega: OTTHUMG00000029693
Pharos: Q8WUD1(Tdark)
UniProt: Q8WUD1
Structure
PDB: 

Position
14q11.2
AA seq 216 aa AA seqDB search
MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNK
SDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLFDVHN
EANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgacttatgcttatctcttcaagtatatcatcatcggagacacaggtgtggggaagtca
tgtctcctcctgcagtttacagataagcggttccagcctgtccacgacctcacaataggt
gtggagtttggagctcgtatggtcaacattgatggaaaacaaatcaaactgcaaatctgg
gatacggctgggcaagaatccttccgttctatcacccgttcctactacaggggagcagct
ggagcactgctggtgtacgacattacaaggcgtgaaaccttcaaccacctgacctcatgg
ttagaggatgcccggcagcactctagttccaacatggttatcatgctcattgggaataag
agtgacctagagtcccgcagggatgtgaagagagaagaaggagaggcctttgctagggag
catggacttatattcatggaaacttcagccaaaacagcctgcaatgttgaagaggccttc
attaacacagccaaagaaatatataggaagatccagcagggtttatttgatgtccacaat
gaggcaaatggcatcaagattgggccccaacagtcaatttcaacatcagtgggacccagt
gcctcccagcggaactctcgtgacatagggtccaactctggctgctgctga

DBGET integrated database retrieval system