KEGG   Homo sapiens (human): 84934Help
Entry
84934             CDS       T01001                                 

Gene name
RITA1, C12orf52, RITA
Definition
(RefSeq) RBPJ interacting and tubulin associated 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RITA
Motif
Other DBs
NCBI-GeneID: 84934
NCBI-ProteinID: NP_116237
HGNC: 25925
Ensembl: ENSG00000139405
Vega: OTTHUMG00000169643
Pharos: Q96K30(Tdark)
UniProt: Q96K30 A0A024RBL1
Position
12q24.13
AA seq 269 aa AA seqDB search
MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKA
NRTRGVGKEASKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSE
GASFGAPRMAKGDAAKLRALLWTPPPTPRGSHSPRPREAPLRAIHPAGPSKTEPGPAADS
QKLSMGGLHSSRPLKRGLSHSLTHLNVPSTGHPATSAPHTNGPQDLRPSTSGVTFRSPLV
TSRARSVSISVPSTPRRGGATQKPKPPWK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccccgtggagctggccgtcagtgggatgcagaccctcggccttcagcaccgc
tgccgaggtggctaccgggtcaaggccaggacgtcatatgtggatgagactctgtttggc
agcccagcaggcacccggcctaccccaccggacttcgatccgccctgggtggagaaggct
aacagaaccagaggcgtgggcaaggaggcatcgaaggccttgggggcaaaggggagctgt
gagaccaccccctcaaggggcagcacccccaccctcacaccaaggaagaagaacaaatac
agacccatcagccacaccccgtcttactgtgatgagtcgctgtttggctcccgatctgaa
ggcgccagcttcggggccccgcggatggcgaagggggatgccgcaaagctccgtgctctc
ttgtggacgccaccacctacccccaggggtagccactcgccccgccccagggaggcacca
ctgcgagccattcacccagctggtccctccaagacagagccggggccagcggcagactcc
cagaagttatctatgggtgggttacactcttcacgccccctgaagcggggactttcccat
tccctcacccacctgaatgtccccagcactggtcatccagccaccagtgccccccacaca
aatgggcctcaggatctcaggccttccacgtcaggggtgaccttccggagccccctggtg
acttccagggctcgctcagttagcatttcagtgccatctaccccacgacgaggtggggcc
acccagaaaccaaagcccccttggaaatga

DBGET integrated database retrieval system