KEGG   Homo sapiens (human): 84940
Entry
84940             CDS       T01001                                 
Symbol
CORO6, ClipinE
Name
(RefSeq) coronin 6
  KO
K13886  coronin-1B/1C/6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    84940 (CORO6)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     84940 (CORO6)
SSDB
Motif
Pfam: DUF1899 WD40_4 WD40 ANAPC4_WD40 NBCH_WD40 Coatomer_WDAD
Other DBs
NCBI-GeneID: 84940
NCBI-ProteinID: NP_116243
HGNC: 21356
Ensembl: ENSG00000167549
Pharos: Q6QEF8(Tdark)
UniProt: Q6QEF8 B3KRY9
Structure
Position
17:complement(29614762..29622912)
AA seq 472 aa
MSRRVVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSSFCAVNPKFLAIIVEAGGGGAFI
VLPLAKTGRVDKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQIPDYTPMRNI
TEPIITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDVIHS
VCWNSNGSLLATTCKDKTLRIIDPRKGQVVAERFAAHEGMRPMRAVFTRQGHIFTTGFTR
MSQRELGLWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEP
PFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQD
DLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPR
RSQSASDAPLSQQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgagcagacgtgtggttcggcaaagcaagttccgccatgtgtttgggcaggcagcaaag
gccgaccaggcctacgaggacatccgtgtgtccaaggtcacatgggacagctccttctgt
gccgtcaaccccaaattcctggccattattgtggaggctggaggcgggggtgccttcatc
gtcctgcctctggccaagacagggcgagtggataagaactacccactggtcactgggcac
actgcccctgtgctggatattgactggtgtccacacaatgacaacgttatcgccagtgcc
tcagacgacaccaccatcatggtgtggcagattccagactatacccccatgcgcaacatt
acggaacctatcatcacacttgagggccactccaagcgtgtgggcatcctctcctggcac
cctactgccaggaatgtcctgctcagtgcaggtggtgacaatgtgatcatcatctggaat
gtgggcaccggggaggtgctgctgagcctggatgatatgcacccagacgtcatccacagt
gtgtgctggaacagcaacggtagcctgctagccaccacctgcaaggacaagaccttgcgc
atcattgaccccagaaaaggccaagtggtggcggagaggtttgcggcccacgaggggatg
aggcccatgcgggccgtcttcacgcgccagggccatatcttcaccacgggcttcacccgc
atgagccagcgagagctgggcctgtgggacccgaacaacttcgaggagccagtggcactg
caggagatggacacaagcaacggggtcctattgcccttttacgatcccgactccagcatc
gtctacctgtgtggcaagggcgacagcagcattcggtactttgagattaccgacgagccg
cctttcgtgcactacctgaacacgttcagcagcaaagagccgcagcggggcatgggtttc
atgcccaaaaggggactggatgtcagcaagtgtgagatcgcccggttctacaagctacac
gaaagaaagtgtgaacctatcatcatgactgtgccccgcaagtcagacctcttccaggac
gatctgtacccggatacgccaggcccggagccggccctagaagcggacgaatggctatcc
ggccaggacgccgaacccgtgctcatttcgctgagggacggctatgtgccccccaagcac
cgcgagctccgggtcacgaagcgcaacatcctggacgtgcgcccgccctccggcccccgc
cgcagccagtcggccagcgacgcccccttgtcgcagcagcacaccctggagacgctgctg
gaagagatcaaggccctccgcgagcgggtgcaggcccaggagcagcgcatcacggctctg
gagaacatgctgtgcgagctggtggacggcacggactag

DBGET integrated database retrieval system