KEGG   Homo sapiens (human): 84941
Entry
84941             CDS       T01001                                 
Symbol
HSH2D, ALX, HSH2
Name
(RefSeq) hematopoietic SH2 domain containing
  KO
K23699  hematopoietic SH2 domain-containing protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    84941 (HSH2D)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   84941 (HSH2D)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 84941
NCBI-ProteinID: NP_116244
OMIM: 608349
HGNC: 24920
Ensembl: ENSG00000196684
Pharos: Q96JZ2(Tbio)
UniProt: Q96JZ2
Structure
Position
19:16134028..16158575
AA seq 352 aa
MTEAGKLPLPLPPRLDWFVHTQMGQLAQDGVPEWFHGAISREDAENLLESQPLGSFLIRV
SHSHVGYTLSYKAQSSCCHFMVKLLDDGTFMIPGEKVAHTSLDALVTFHQQKPIEPRREL
LTQPCRQKDPANVDYEDLFLYSNAVAEEAACPVSAPEEASPKPVLCHQSKERKPSAEMNR
ITTKEATSSCPPKSPLGETRQKLWRSLKMLPERGQRVRQQLKSHLATVNLSSLLDVRRST
VISGPGTGKGSQDHSGDPTSGDRGYTDPCVATSLKSPSQPQAPKDRKVPTRKAERSVSCI
EVTPGDRSWHQMVVRALSSQESKPEHQGLAEPENDQLPEEYQQPPPFAPGYC
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacagaggccgggaagctgcccctaccgctacccccacggctggactggtttgtgcac
acccagatgggccagctggcccaagacggggtccccgagtggttccatggtgcaatctca
agagaggatgctgagaacttgctggagtcacagccactgggatcctttctcatcagggtc
agtcacagccatgtgggctacacactctcctacaaagcccaaagcagctgctgccatttc
atggtgaagctcttggatgatgggactttcatgatccccggggagaaggtggcccacacc
tcgctggacgccctggtcaccttccaccagcagaagccaattgagccgcgcagggagctg
ctgacacagccctgcaggcagaaggatcccgcaaacgtggattacgaggatctcttcctc
tactccaacgcagtggccgaggaagctgcctgcccggtgtctgcccctgaggaggcctcc
ccaaagccagtcctgtgtcaccaatcaaaggaaaggaagccgtcagcagagatgaacaga
ataaccaccaaggaagccacttcctcctgccccccaaaatcccctcttggagagacccgc
cagaaactctggaggagcctcaaaatgctccccgagagaggccagagggtccggcagcag
ctaaaaagccacctcgccactgtgaacttgtcgtcactcttggatgtccggagatccacg
gtgatctcaggccctgggaccggaaaaggcagccaagatcactcaggggatcccacctcg
ggggacagaggctacacggatccctgtgtggccacatctctcaaaagcccctcacagccc
caggcaccaaaagacagaaaggtccccaccaggaaggccgagaggtcggtcagctgcatt
gaggtgaccccaggggacaggagttggcaccaaatggtagtgagagccctatcctcccag
gagtccaagccagagcaccagggcttggcagagcctgagaacgaccagctcccggaggag
taccaacaaccgccaccctttgcccctgggtactgctag

DBGET integrated database retrieval system