KEGG   Homo sapiens (human): 84947Help
Entry
84947             CDS       T01001                                 

Gene name
SERAC1
Definition
(RefSeq) serine active site containing 1
  KO
K23504  protein SERAC1
Organism
hsa  Homo sapiens (human)
Disease
H00754  3-Methylglutaconic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    84947 (SERAC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    84947 (SERAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGAP1 Hydrolase_4 Abhydrolase_6 LCAT
Motif
Other DBs
NCBI-GeneID: 84947
NCBI-ProteinID: NP_116250
OMIM: 614725
HGNC: 21061
Ensembl: ENSG00000122335
Vega: OTTHUMG00000015905
Pharos: Q96JX3(Tbio)
UniProt: Q96JX3
Position
6q25.3
AA seq 654 aa AA seqDB search
MSLAAYCVICCRRIGTSTSPPKSGTHWRDIRNIIKFTGSLILGGSLFLTYEVLALKKAVT
LDTQVVEREKMKSYIYVHTVSLDKGENHGIAWQARKELHKAVRKVLATSAKILRNPFADP
FSTVDIEDHECAVWLLLRKSKSDDKTTRLEAVREMSETHHWHDYQYRIIAQACDPKTLIG
LARSEESDLRFFLLPPPLPSLKEDSSTEEELRQLLASLPQTELDECIQYFTSLALSESSQ
SLAAQKGGLWCFGGNGLPYAESFGEVPSATVEMFCLEAIVKHSEISTHCDKIEANGGLQL
LQRLYRLHKDCPKVQRNIMRVIGNMALNEHLHSSIVRSGWVSIMAEAMKSPHIMESSHAA
RILANLDRETVQEKYQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVI
EKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMERKSIAFRSNELLR
KLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHGSRLA
EYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIGSMIK
LHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREALAKDLEN
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggctgcttattgcgtcatctgttgcagaagaataggaacctctacttcccca
ccaaaaagtggcacacactggagagatatcagaaatataataaagtttactggatcactt
attttaggaggttctttatttcttacatatgaagttctggccctgaagaaggctgtgaca
ttagatactcaagtggtagaacgagaaaaaatgaagtcatatatatatgtgcacacagtt
tctttagacaaaggagaaaatcatggtattgcctggcaggcaagaaaagaacttcacaaa
gcagtaagaaaagtattggcaacatcagccaagatactgcggaatccatttgctgatcct
tttagtacagttgatatagaagatcatgagtgtgctgtgtggctgctcctacggaagagc
aagtcagatgacaaaaccacgcgactcgaggctgtgcgggaaatgtcggagacccatcac
tggcatgattaccagtataggataattgctcaagcctgtgatccgaaaactcttattggt
ttggcacgaagcgaagagagtgatcttcgcttttttctcctaccacctcctttgccatct
ttaaaagaagattcttccactgaagaagagctcagacagttgctggcttccttacctcaa
acagagctagatgagtgtatccagtattttacatctttggctcttagtgaaagcagtcag
agtctagctgctcagaagggtggtttatggtgttttggaggaaatggacttccttatgct
gaaagttttggagaagttccttcagcaacagtggaaatgttctgtttagaagctatagta
aaacattctgagatatccacacattgtgataaaatcgaagcaaatggaggcctgcagcta
cttcagaggctgtaccgacttcacaaggactgccctaaagtacagagaaatataatgcgt
gtcattggaaatatggctttgaatgaacatcttcattcttctatagttcgctcaggctgg
gtttccatcatggcagaagcaatgaaatctccccacattatggagtcctcacacgctgcc
agaatcctggcaaatctagaccgagaaactgtgcaagaaaaatatcaggatggcgtatat
gtgctgcatccccaatatcgaacaagtcagcccattaaagcagatgtcctttttattcat
ggccttatgggagcagcattcaaaacatggcgccagcaggacagtgagcaggctgtaatt
gaaaaacctatggaggatgaagacagatatacgacgtgctggcccaagacatggttagca
aaagactgtcctgctctccgaattatatctgtggagtatgacaccagcctcagcgactgg
agagcaaggtgccctatggaaagaaagtccattgcattcagaagcaacgaacttcttagg
aagctcagagctgctggtgttggggataggccagtggtttggatatcacatagcatggga
ggtcttcttgtcaaaaagatgctgttggaagcctctacgaagccagaaatgagtactgtt
atcaacaataccagaggaataattttttatagtgtccctcatcatggatcacgtttggct
gaatactctgttaatattcgctatcttctcttcccctcgttggaagtcaaagaactcagc
aaggattctcctgcacttaaaacactacaagatgactttctggagtttgctaaagacaaa
aacttccaggtgctgaattttgtggaaacactaccaacctacattggcagcatgattaag
ctccatgtggtacctgtggaatcagcagatttaggcattggagatctaattcctgtggat
gttaaccatttgaacatttgtaagccaaagaaaaaggatgcttttttgtaccagcgtact
ttacaattcattcgtgaagctttagccaaagaccttgaaaactaa

DBGET integrated database retrieval system