KEGG   Homo sapiens (human): 84957Help
Entry
84957             CDS       T01001                                 

Gene name
RELT, TNFRSF19L, TRLT
Definition
(RefSeq) RELT, TNF receptor
  KO
K05156  tumor necrosis factor receptor superfamily member 19-like
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    84957 (RELT)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   84957 (RELT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RELT TNFR_c6
Motif
Other DBs
NCBI-GeneID: 84957
NCBI-ProteinID: NP_116260
OMIM: 611211
HGNC: 13764
Ensembl: ENSG00000054967
Vega: OTTHUMG00000167973
Pharos: Q969Z4(Tbio)
UniProt: Q969Z4 A0A024R5N3
Position
11q13.4
AA seq 430 aa AA seqDB search
MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAW
GSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHG
CDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAAQYAVIAIVPVFCLMGLLGI
LVCNLLKRKGYHCTAHKEVGPGPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAA
LEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQ
KKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRFRVARIPEQRT
SSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYV
VRLSESNLVI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaagtctgctgtgccggcccctgtcctgcttccttatgctgctgccctggcct
ctcgccaccctgacatcaacaaccctttggcagtgcccacctggggaggagcccgacctg
gacccagggcagggcacattatgcaggccctgccccccaggcaccttctcagctgcatgg
ggctccagcccatgccagccccatgcccgttgcagcctttggaggaggctggaggcccag
gtgggcatggcaactcgagatacactctgtggagactgctggcctgggtggtttgggcct
tggggggttccccgcgttccatgtcaaccatgttcctgggcacctctgggtactcatggc
tgtgatgagtgggggcggcgggcccgacgtggcgtggaggtggcagcaggggccagcagc
ggtggtgagacacggcagcctgggaacggcacccgggcaggtggcccagaggagacagcc
gcccagtacgcggtcatcgccatcgtccctgtcttctgcctcatggggctgttgggcatc
ctggtgtgcaacctcctcaagcggaagggctaccactgcacggcgcacaaggaggtcggg
cccggccctggaggtggaggcagtggaatcaaccctgcctaccggactgaggatgccaat
gaggacaccattggggtcctggtgcgcttgatcacagagaagaaagagaatgctgcggcc
ctggaggagctgctgaaagagtaccacagcaaacagctggtgcagacgagccacaggcct
gtgtccaagctgccgccagcgcccccgaacgtgccacacatctgcccgcaccgccaccat
ctccacaccgtgcagggcctggcctcgctctctggcccctgctgctcccgctgtagccag
aagaagtggcccgaggtgctgctgtcccctgaggctgtagccgccactactcctgttccc
agccttctgcctaacccgaccagggttcccaaggccggggccaaggcagggcgtcagggc
gagatcaccatcttgtctgtgggcaggttccgcgtggctcgaattcctgagcagcggaca
agttcaatggtgtctgaggtgaagaccatcacggaggctgggccctcgtggggtgatctc
cctgactccccacagcctggcctcccccctgagcagcaggccctgctaggaagtggcgga
agccgtacaaagtggctgaagcccccagcagagaacaaggccgaggagaaccgctatgtg
gtccggctaagtgagagcaacctggtcatctga

DBGET integrated database retrieval system