KEGG   Homo sapiens (human): 84959Help
Entry
84959             CDS       T01001                                 

Gene name
UBASH3B, STS-1, STS1, TULA-2, TULA2, p70
Definition
(RefSeq) ubiquitin associated and SH3 domain containing B
  KO
K18993  ubiquitin-associated and SH3 domain-containing protein [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    84959 (UBASH3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     84959 (UBASH3B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Suppressors of T-cell receptor signaling
    84959 (UBASH3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 His_Phos_1 UBA SH3_1 2_5_RNA_ligase2 LigT_PEase DSPc
Motif
Other DBs
NCBI-GeneID: 84959
NCBI-ProteinID: NP_116262
OMIM: 609201
HGNC: 29884
Ensembl: ENSG00000154127
Vega: OTTHUMG00000166025
Pharos: Q8TF42(Tbio)
UniProt: Q8TF42
Structure
PDB: 

Position
11q24.1
AA seq 649 aa AA seqDB search
MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALAS
TGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKA
HNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKED
SAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGC
DWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS
LTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGET
TPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHN
ILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKL
VVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ
MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtacggccaccccagtccgctcggcatggctgcgagagaggagctgtacagc
aaagtcaccccccggaggaaccgccaacagcgccccggcaccatcaagcatggatcggcg
ctggacgtgctcctctccatggggttccccagagcccgcgcacaaaaagccttggcatcc
acgggaggaagaagtgttcaggcagcatgtgactggttattctcccatgtcggtgacccc
ttcctggatgaccccctgccccgggagtacgtcctctacctccgtcccaccggcccctta
gcacagaagctttccgacttttggcagcagtcgaagcagatctgcgggaagaacaaggca
cacaacatcttcccccacatcacactctgccagttctttatgtgcgaggacagcaaggtg
gatgccctgggggaagccctgcagaccacggtcagtcgctggaaatgtaagttctcggcc
ccgctgcccctggagctctatacgtcgtccaacttcatcggcctctttgtaaaggaagac
agtgcggaggtcctcaagaagtttgctgctgactttgctgcagaggctgcatccaaaacc
gaagtgcatgtggaacctcataagaagcagctacatgtgaccctggcttaccacttccaa
gccagccacctacccaccctagagaaactggcccagaacattgacgtcaagctagggtgt
gactgggtggctaccatattttctcgggatatccgatttgctaaccatgagacattacag
gtcatctacccctataccccacaaaatgacgatgagctggagctggtccccggggacttc
atcttcatgtctccaatggagcagaccagcaccagcgagggttggatctatggcacgtcc
ttaaccaccggctgctctggactcctgcctgagaattacattaccaaggctgatgaatgc
agcacctggatatttcatggttcttattcaatcttaaatacatcgtcatccaactctctc
acgtttggggatggagtattggagaggcggccttatgaggaccaggggctcggggagacg
actcctcttactatcatctgccagcccatgcagccgctgagggtcaacagccagcccggc
ccccagaagcgatgcctttttgtgtgtcggcatggtgagaggatggatgttgtgtttggg
aagtactggctgtcccagtgcttcgatgccaaaggccgctacatacgcaccaacctgaac
atgcctcatagtttacctcagcggagtggtggtttccgagattacgagaaagatgctccc
atcactgtgtttggatgcatgcaagcaagactagtgggtgaagccttattagagagcaat
accattatcgatcatgtctattgctccccgtcccttcgctgcgttcagactgcacacaat
atcttgaaaggtttacaacaagaaaatcacttgaagatccgtgtagagcccggcttattt
gagtggacaaaatgggttgctgggagcacattacctgcatggatacctccatcagagtta
gctgcagccaacctgagtgttgatacaacctacagacctcacattccaatcagcaaatta
gttgtttcagaatcctatgatacttatatcagtagaagtttccaagtaacaaaagaaata
ataagtgaatgtaaaagtaaaggaaataacatcctgattgtggcccacgcatcttccctt
gaagcgtgtacctgccaacttcagggcctgtcacctcagaactccaaggacttcgtacaa
atggtccgaaagatcccatatctgggattttgttcctgtgaagaattaggagaaactgga
atatggcagctgacagatccaccaatccttcctcttacccatggaccaactgggggcttc
aactggagagagaccttgcttcaagaataa

DBGET integrated database retrieval system