KEGG   Homo sapiens (human): 84960
Entry
84960             CDS       T01001                                 
Symbol
CCDC183, KIAA1984, PARF, bA216L13.7
Name
(RefSeq) coiled-coil domain containing 183
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 84960
NCBI-ProteinID: NP_001034463
OMIM: 615955
HGNC: 28236
Ensembl: ENSG00000213213
Pharos: Q5T5S1(Tdark)
UniProt: Q5T5S1 Q96IG8
Position
9:136796338..136807741
AA seq 534 aa
MRRHSETDVEEQTQELKTITQLQEQCRALQIQGVKENMDQNKATLALLRSNIRRGAQDWA
LAKKYDQWTISKACGKNLPLRLAHCRSTMEVVREKLRKYVFDRVNMHNLLIHLVRRRGQK
LESMQLELDSLRSQPDASKEELRLLQIIRQLENNIEKTMIKIITSQNIHLLYLDLLDYLK
TVLAGYPIELDKLQNLVVNYCSELSDMKIMSQDAMMITDEVKRNMRQREASFIEERRARE
NRLNQQKKLIDKIHTKETSEKYRRGQMDLDFPSNLMSTETLKLRRKETSTAEMEYQSGVT
AVVEKVKSAVRCSHVWDITSRFLAQRNTEENLELQMEDCEEWRVQLKALVKQLELEEAVL
KFRQKPSSISFKSVEKKMTDMLKEEEERLQLAHSNMTKGQELLLTIQMGIDNLYVRLMGI
NLPATQREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEK
YNTRISFENREEDMIDTFQFPDMDHSYVPSRAEIKRQAQRLIEGKLKAAKKKKK
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgaggaggcacagtgagacagatgtggaagagcagacccaggagctgaagaccatcact
cagctccaggagcagtgtcgggcactccagatccaaggggtgaaagagaatatggaccag
aacaaggccacgctggccctcctgcgcagcaacatccgccgcggggcccaggactgggct
ttggccaagaagtatgaccagtggaccatctccaaggcctgcgggaaaaacttgcctttg
cgactggcgcactgccgcagcaccatggaggtggtgcgggagaagctgcgcaagtacgtc
ttcgaccgcgtgaacatgcacaacctactgatccacctggtgcggcggcgcgggcagaag
ctggagagcatgcagctggagctggacagcctgcggagccagcccgacgccagcaaggag
gagctgcggctgctgcagatcatccgccagctggagaacaacatcgagaagacaatgatc
aagatcatcaccagccagaacatccacctgctgtatttggacctgctggattatctgaag
acagtgctggcaggataccccattgagctggacaagctgcagaacctcgtggtcaactac
tgctcagagctgtcggatatgaagatcatgtcccaagatgccatgatgatcacggatgag
gtcaagaggaacatgaggcaaagggaggcgtccttcatcgaggagcgccgggcaagggag
aaccggctcaaccagcagaagaagctgatcgacaagatccacacgaaggagaccagcgag
aagtaccgccggggccagatggacttggacttcccctcgaacctgatgagcacggagacc
ctgaaattgaggagaaaagagacctccacagcagaaatggaataccagtcgggcgtgact
gctgtggtggagaaggtcaagagtgctgtacggtgctctcacgtctgggacatcactagc
cgcttcctggcccagaggaacacggaggagaacctggagctgcagatggaggactgtgag
gagtggcgggtgcagctgaaggccctggtgaagcagctggagctggaggaggccgtgctc
aagttccgccagaagcctagctccatcagcttcaagtccgttgagaagaaaatgacagac
atgctaaaagaggaagaagagaggctccagctggcgcacagcaacatgaccaagggccag
gagctgctgctgaccatccagatgggcatcgacaacctctatgtccggctgatgggcatt
aacttgcctgcgacccagagagaagtggtgctctccaacaccctcgatttgaacagcaag
ctggcgtactgcgaggggaagctcacgtacctggctgacagagtgcagatggtgtccagg
accgaggagggcgacacaaaggtgagggacaccctggagtcctcgactctgatggagaag
tacaacaccaggatcagctttgagaaccgggaggaggatatgatcgacaccttccagttc
cccgacatggaccacagctacgtcccttcgcgcgccgagatcaagaggcaggcgcagcgg
ctaatcgaggggaagctcaaggcggccaagaaaaagaagaagtag

DBGET integrated database retrieval system