KEGG   Homo sapiens (human): 84962Help
Entry
84962             CDS       T01001                                 

Gene name
AJUBA, JUB
Definition
(RefSeq) ajuba LIM protein
  KO
K16682  LIM domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    84962 (AJUBA)
   04392 Hippo signaling pathway - multiple species
    84962 (AJUBA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    84962 (AJUBA)
   03036 Chromosome and associated proteins [BR:hsa03036]
    84962 (AJUBA)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     84962 (AJUBA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     84962 (AJUBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM
Motif
Other DBs
NCBI-GeneID: 84962
NCBI-ProteinID: NP_116265
OMIM: 609066
HGNC: 20250
Ensembl: ENSG00000129474
Vega: OTTHUMG00000028711
Pharos: Q96IF1(Tbio)
UniProt: Q96IF1
Position
14q11.2
AA seq 538 aa AA seqDB search
MERLGEKASRLLEKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPRGATGGPGDEP
LEPAREQGSLDAERNQRGSFEAPRYEGSFPAGPPPTRALPLPQSLPPDFRLEPTAPALSP
RSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYDQRHGSPLPAG
PCLFGPPLAGAPAGYSPGGVPSAYPELHAALDRLYAQRPAGFGCQESRHSYPPALGSPGA
LAGAGVGAAGPLERRGAQPGRHSVTGYGDCAVGARYQDELTALLRLTVGTGGREAGARGE
PSGIEPSGLEEPPGPFVPEAARARMREPEAREDYFGTCIKCNKGIYGQSNACQALDSLYH
TQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLILEKILQAMGK
SYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIV
RVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggagcggttaggagagaaagccagtcgcctgctggagaagttcggccgcagaaagggt
gaatctagccggtctgggtctgacgggacccccgggccgggcaaggggcgcctaagtggg
ttggggggacctaggaagtcagggccccgaggagctactgggggacctggggatgagccg
ttggagccggcccgggagcaaggttccctggacgctgagcgaaatcagcgcggctccttt
gaggcgccgcgctacgaaggctcttttcccgcggggccgccgcccacccgggccttgcct
ctacctcagtcgttgccccccgattttcggctggagcccacggccccggccctcagcccc
cgctctagcttcgccagtagctcggccagcgacgcgagcaagccgtccagcccccggggc
agcctgctgctggacggggcgggggctggcggagctggaggtagccggccctgcagcaat
cgcaccagcggcatcagcatgggctacgaccagcgccacgggagccccttgccagcgggg
ccgtgcctgtttggcccacccctggccggagcaccggcaggctattctcccggaggggtc
ccgtccgcctacccggagctccacgccgccctggaccgattgtacgctcagcggcccgcg
gggttcggctgccaggaaagccgccactcgtatcccccggccctgggcagccctggagct
ctagccggggccggagtgggagcggcggggcccttggagagacggggggcgcaacccgga
cgacactctgtgaccggctacggggactgcgccgtgggcgcccggtaccaggacgagcta
acagctttgcttcgcctgacggtgggcaccggtgggcgagaagccggagcccgcggagaa
ccctcggggattgagccgtcgggtctggaggagccaccaggtcctttcgttccggaggcc
gcccgggcccggatgcgggagccagaggccagggaggactacttcggcacctgtatcaag
tgcaacaaaggcatctatgggcagagcaatgcctgccaggccctggacagcctctaccac
acccagtgctttgtttgctgctcttgtgggcgaactttgcgttgcaaggctttctacagt
gtcaatggctctgtgtactgtgaggaagattatctgttttcagggtttcaggaggcagct
gagaaatgctgtgtctgtggtcacttgattttggagaagatcctacaagcaatggggaag
tcctatcatccaggctgtttccgatgcattgtttgcaacaagtgcctggatggcatcccc
ttcacagtggacttctccaaccaagtatactgtgtcaccgactaccacaaaaattatgct
cctaagtgtgcagcctgtggccaacccatcctcccctctgagggctgtgaggacatcgtg
agggtgatatccatggaccgggattatcactttgagtgctaccactgtgaggactgccgg
atgcagctgagtgatgaggaaggctgctgctgtttccctctggatgggcacttgctctgc
catggttgccacatgcagcggctcaatgcccgacaaccccctgccaactatatctga

DBGET integrated database retrieval system