KEGG   Homo sapiens (human): 84964
Entry
84964             CDS       T01001                                 
Symbol
ALKBH6, ABH6
Name
(RefSeq) alkB homolog 6
  KO
K10768  alkylated DNA repair protein alkB homolog 6 [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    84964 (ALKBH6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-
     84964 (ALKBH6)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2
Other DBs
NCBI-GeneID: 84964
NCBI-ProteinID: NP_001284630
OMIM: 613304
HGNC: 28243
Ensembl: ENSG00000239382
Pharos: Q3KRA9(Tdark)
UniProt: Q3KRA9 B4E3P3
Position
19:complement(36009120..36014239)
AA seq 238 aa
MEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQN
WGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLY
YPTVSTISLGSHTVLDFYEPRRPEDDDPTEQPRPPPRPTTSLLLEPRSLLVLRGPAYTRL
LHGIAAARVDALDAASSPPNAAACPSARPGACLVRGTRVSLTIRRVPRVLRAGLLLGK
NT seq 717 nt   +upstreamnt  +downstreamnt
atggaggagcaggacgccagagtcccagccctggaaccgttcagagtggagcaggcacca
cctgtaatctactatgtccctgacttcatctccaaagaagaggaggagtatttgcttcga
caggtttttaatgccccaaagccaaagtggacccagctctctgggagaaagttacagaac
tggggtgggcttcctcatccccgagggatggttcctgagcggctgcccccatggctccag
cgctacgtggacaaagtgtcaaacctcagcctctttggaggcctcccagctaaccatgtc
ctcgtgaaccagtatctgcctggggagggcatcatgccccacgaggacggaccactgtac
tacccgactgtcagcaccatcagcctgggctcccacaccgtgctggacttctacgagccg
cggcggccagaggacgatgaccctacagaacagcctcggcctccgccccggcccaccacc
tcgctactgctggaaccgcgcagcctgctggtgctccgcggccccgcctacacgcgtctt
ctccacggcatcgccgccgcccgcgtagacgcgctggacgccgcctcctcgccgcccaat
gcggcagcctgcccgtcggcgcggccgggagcctgcctggtgcgcggcacccgggtctcg
ctgaccatccgccgcgtgccccgcgtgctgcgcgccggcctcctgctgggcaagtga

DBGET integrated database retrieval system