KEGG   Homo sapiens (human): 84967
Entry
84967             CDS       T01001                                 

Gene name
LSM10, MST074, MSTP074
Definition
(RefSeq) LSM10, U7 small nuclear RNA associated
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: LSM DpnI_C
Other DBs
NCBI-GeneID: 84967
NCBI-ProteinID: NP_116270
OMIM: 617909
HGNC: 17562
Ensembl: ENSG00000181817
Vega: OTTHUMG00000008140
Pharos: Q969L4(Tbio)
UniProt: Q969L4
Position
1p34.3
AA seq 123 aa
MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYT
DRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPK
NCK
NT seq 372 nt   +upstreamnt  +downstreamnt
atggcggtgagccattcagtgaaggagcggaccatctctgagaacagcctgatcatccta
ctgcagggcctccagggccgggtaaccactgtggacctgcgggatgagagcgtggcccac
ggacgcatagacaatgtcgatgctttcatgaacatccgcctggccaaagtcacctacacg
gaccgttgggggcatcaggtcaagctggatgacctctttgtgacaggccgcaatgtccgc
tacgtccacatcccagatgacgtgaacatcacctcgaccattgagcagcagctgcagatt
atccatcgggtgcgaaactttggtggcaagggccaaggccggtgggaatttcccccaaaa
aactgtaagtga

DBGET integrated database retrieval system