KEGG   Homo sapiens (human): 84971Help
Entry
84971             CDS       T01001                                 

Gene name
ATG4D, APG4-D, APG4D, AUTL4
Definition
(RefSeq) autophagy related 4D cysteine peptidase
  KO
K08342  cysteine protease ATG4 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    84971 (ATG4D)
   04136 Autophagy - other
    84971 (ATG4D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    84971 (ATG4D)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84971 (ATG4D)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    84971 (ATG4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     84971 (ATG4D)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C54: Aut2 peptidase family
   84971 (ATG4D)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    84971 (ATG4D)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    84971 (ATG4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C54
Motif
Other DBs
NCBI-GeneID: 84971
NCBI-ProteinID: NP_116274
OMIM: 611340
HGNC: 20789
Ensembl: ENSG00000130734
Vega: OTTHUMG00000180582
Pharos: Q86TL0(Tbio)
UniProt: Q86TL0
Position
19p13.2
AA seq 474 aa AA seqDB search
MNSVSPAAAQYRSSSPEDARRRPEARRPRGPRGPDPNGLGPSGASGPALGSPGAGPSEPD
EVDKFKAKFLTAWNNVKYGWVVKSRTSFSKISSIHLCGRRYRFEGEGDIQRFQRDFVSRL
WLTYRRDFPPLPGGCLTSDCGWGCMLRSGQMMLAQGLLLHFLPRDWTWAEGMGLGPPELS
GSASPSRYHGPARWMPPRWAQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSG
KKAGDWYGPSLVAHILRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSV
VILVPVRLGGETLNPVYVPCVKELLRCELCLGIMGGKPRHSLYFIGYQDDFLLYLDPHYC
QPTVDVSQADFPLESFHCTSPRKMAFAKMDPSCTVGFYAGDRKEFETLCSELTRVLSSSS
ATERYPMFTLAEGHAQDHSLDDLCSQLAQPTLRLPRTGRLLRAKRPSSEDFVFL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagtgtcgccggccgccgcgcagtaccggagcagcagcccggaggacgcgcgc
cgccggcccgaggcccgcaggccgcggggtcccagaggcccagaccccaacggcctgggg
ccttccggagccagcggccccgctcttggctctcccggggctggcccgagtgagccggac
gaagtggacaagttcaaggccaagttcctgacagcctggaacaacgtcaagtacggttgg
gtggttaaaagccggaccagctttagcaagatctccagcatccacctctgtggccgccgc
taccgtttcgagggcgagggtgacatacagcgtttccagcgggactttgtgtcccgcctg
tggctcacataccgccgggacttcccgccccttcctgggggctgcctgacctcggactgt
ggctgggggtgcatgttacgcagcggccagatgatgctggcacagggccttctgctgcat
ttcctgcccagagactggacatgggccgagggcatgggcctgggcccccctgagctgtca
gggtcagcctctcccagccggtaccatgggcctgcccgctggatgcccccacgctgggcc
cagggtgcccctgagctggagcaggaacgccggcaccggcagattgtgtcctggttcgcc
gaccacccccgggccccctttggcctacaccggctggtggagcttgggcagagctcaggc
aagaaggcaggtgactggtatgggccatcgctagtggcacacatcctcaggaaagccgtg
gagagctgctccgacgtcacccgcctggtggtgtacgtttctcaggactgcacagtgtac
aaggcggatgtggcacgcctggtggccaggccagaccccacagccgagtggaagtctgtg
gtcatcctggtgcccgtgcgactgggtggcgagactctcaaccccgtgtatgtgccctgc
gtgaaggaactcctgcgttgcgagctgtgcctgggcatcatgggtgggaaaccgcgacac
tcactgtacttcattggctaccaagatgacttcctgctgtacctggaccctcactactgc
cagcccactgtggatgtcagccaggccgacttccccctggagtccttccactgcacctcg
ccccgcaagatggcctttgccaagatggacccaagctgtaccgtgggcttctatgctgga
gacaggaaggagtttgagacactctgctcagagctgaccagggtcctcagctcctcctca
gccacagagcggtaccccatgttcaccctggccgagggccatgctcaggaccacagcctg
gacgacctctgctcccagctcgcccagcccacactccggctccctcgcacagggcggctc
ctcagggccaaacgccccagctctgaggactttgtgtttttataa

DBGET integrated database retrieval system