KEGG   Homo sapiens (human): 8498Help
Entry
8498              CDS       T01001                                 

Gene name
RANBP3
Definition
(RefSeq) RAN binding protein 3
  KO
K15304  Ran-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8498 (RANBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ran_BP1 G_path_suppress
Motif
Other DBs
NCBI-GeneID: 8498
NCBI-ProteinID: NP_015561
OMIM: 603327
HGNC: 9850
Ensembl: ENSG00000031823
Vega: OTTHUMG00000180636
Pharos: Q9H6Z4(Tbio)
UniProt: Q9H6Z4
Structure
PDB: 

Position
19p13.3
AA seq 567 aa AA seqDB search
MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHHGTGHPESAGE
HALEPPAPAGASASTPPPPAPEAQLPPFPRELAGRSAGGSSPEGGEDSDREDGNYCPPVK
RERTSSLTQFPPSQSEERSSGFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAP
QPKALSQTVPSSGTNGVSLPADCTGAVPAASPDTAAWRSPSEAADEVCALEEKEPQKNES
SNASEEEACEKKDPATQQAFVFGQNLRDRVKLINESVDEADMENAGHPSADTPTATNYFL
QYISSSLENSTNSADASSNKFVFGQNMSERVLSPPKLNEVSSDANRENAAAESGSESSSQ
EATPEKESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWVE
RGRGLLRLNDMASTDDGTLQSRLVMRTQGSLRLILNTKLWAQMQIDKASEKSIRITAMDT
EDQGVKVFLISASSKDTGQLYAALHHRILALRSRVEQEQEAKMPAPEPGAAPSNEEDDSD
DDDVLAPSGATAAGAGDEGDGQTTGST
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggcgaacgaagaaaagcctgccattgctccgcccgtctttgtgtttcag
aaggataaaggacaaaagtcccctgcagagcaaaaaaacttgtcggattcgggagaggag
cctcggggggaggctgaggccccccaccatggcacgggtcaccccgagtcagctggcgag
catgccctagaacctcctgcccctgctggcgcctcagccagcactcctccgcctcccgct
cctgaagcccagcttcctccttttccgcgagaactggcagggaggtcagctggcggctcc
agtcctgaaggcggagaagattctgacagagaagatggaaattactgccctcctgtcaag
cgagaaagaacatcctctttaacccagttcccaccctcacagtcagaggaaaggagcagt
ggcttccggttgaagccaccaacgctgatccacggccaagcccccagcgcaggtctgcca
agccagaagcccaaggagcagcagcggagcgtgcttcgcccggcagtgttacaagctccg
cagccaaaggcgctgtcccagactgtccccagcagtggcaccaacggggtcagcctccca
gcagactgcacgggggcagtgcccgcagcatcccctgacactgctgcatggagaagtcct
tccgaagctgccgatgaggtgtgtgcacttgaggagaaagagccccagaaaaatgagtcc
agcaatgcctctgaagaggaagcctgtgagaaaaaagaccccgccacacagcaagccttt
gtatttgggcagaacttgagggacagagttaagctgataaatgagagcgtggacgaagcc
gacatggagaatgctggacaccccagcgcagacacgccaaccgcaacgaactatttcctc
cagtatatcagttccagtttagagaactcaaccaatagtgccgacgcctccagcaacaaa
tttgtatttggccagaacatgagcgagcgagttttgagccccccaaaattaaacgaggtc
agttcagatgccaacagggaaaatgcagctgccgagtcagggtctgagtcctcgtcccag
gaggccacccctgagaaagagtccctggctgagtcggcagccgcctacaccaaggcaaca
gcgcggaagtgtttgttggaaaaagtggaagtcatcaccggggaggaggcggagagcaat
gtgttacagatgcagtgcaagctgtttgtctttgacaagacctcacagtcctgggtggag
agaggccgggggctgctcagactcaatgacatggcgtccaccgatgacggcacactacag
tcccgactagtgatgcggacccaggggagcctgcgactgatcctcaacaccaagctgtgg
gcccagatgcagatcgacaaggccagcgagaagagcattcgcatcacagccatggacacc
gaggaccagggcgtgaaggtcttcctgatctcggccagctccaaggacacaggtcagttg
tatgcagccctgcaccaccgcatcctggccctgcgcagccgcgtggagcaggagcaggag
gccaagatgcccgcgcctgagcctggggcagccccatccaacgaggaggacgacagcgac
gatgacgatgtcctggctccttcaggggccaccgcagctggtgctggtgacgaaggggac
gggcagacgaccgggagcacatag

DBGET integrated database retrieval system