KEGG   Homo sapiens (human): 84984
Entry
84984             CDS       T01001                                 
Symbol
CEP19, C3orf34, MOSPGF
Name
(RefSeq) centrosomal protein 19
  KO
K16801  centrosomal protein CEP19
Organism
hsa  Homo sapiens (human)
Disease
H02235  Morbid obesity and spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    84984 (CEP19)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    84984 (CEP19)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    84984 (CEP19)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   84984 (CEP19)
SSDB
Motif
Pfam: CEP19
Other DBs
NCBI-GeneID: 84984
NCBI-ProteinID: NP_116287
OMIM: 615586
HGNC: 28209
Ensembl: ENSG00000174007
Pharos: Q96LK0(Tdark)
UniProt: Q96LK0
Position
3:complement(196706277..196712250)
AA seq 163 aa
MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKS
YLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIM
DELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF
NT seq 492 nt   +upstreamnt  +downstreamnt
atgatgtgcactgccaagaaatgtgggattaggtttcagcctccagctattatcttaatc
tatgagagtgaaatcaaggggaaaattcgccagcgcattatgccagttcgaaacttttca
aagttttcagattgcaccagagctgctgaacaattaaagaataatccgcgacacaagagt
tacctagaacaagtatccctgaggcagctagagaagctattcagttttttacgaggttac
ttgtcggggcagagtctggcagaaacaatggaacaaattcaacgggaaacaaccattgat
cctgaggaagacctgaacaaactagatgacaaggagcttgccaaaagaaagagcatcatg
gatgaactttttgagaaaaatcagaagaagaaggatgatccaaattttgtttatgacatt
gaggttgaatttccacaggacgatcaactgcagtcctgtggctgggacacagagtcagct
gatgagttctga

DBGET integrated database retrieval system