KEGG   Homo sapiens (human): 84985
Entry
84985             CDS       T01001                                 
Symbol
FAM83A, BJ-TSA-9
Name
(RefSeq) family with sequence similarity 83 member A
  KO
K23930  protein FAM83
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    84985 (FAM83A)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  Others
   84985 (FAM83A)
SSDB
Motif
Pfam: FAM83 PLDc_2
Other DBs
NCBI-GeneID: 84985
NCBI-ProteinID: NP_116288
HGNC: 28210
Ensembl: ENSG00000147689
Pharos: Q86UY5(Tbio)
UniProt: Q86UY5
Structure
Position
8:123179047..123210079
AA seq 434 aa
MSRSRHLGKIRKRLEDVKSQWVRPARADFSDNESARLATDALLDGGSEAYWRVLSQEGEV
DFLSSVEAQYIQAQAREPPCPPDTLGGAEAGPKGLDSSSLQSGTYFPVASEGSEPALLHS
WASAEKPYLKEKSSATVYFQTVKHNNIRDLVRRCITRTSQVLVILMDVFTDVEIFCDILE
AANKRGVFVCVLLDQGGVKLFQEMCDKVQISDSHLKNISIRSVEGEIYCAKSGRKFAGQI
REKFIISDWRFVLSGSYSFTWLCGHVHRNILSKFTGQAVELFDEEFRHLYASSKPVMGLK
SPRLVAPVPPGAAPANGRLSSSSGSASDRTSSNPFSGRSAGSHPGTRSVSASSGPCSPAA
PHPPPPPRFQPHQGPWGAPSPQAHLSPRPHDGPPAAVYSNLGAYRPTRLQLEQLGLVPRL
TPTWRPFLQASPHF
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgagccggtcaaggcacctgggcaaaatccggaagcgtctggaagatgtcaagagccag
tgggtccggccagccagggctgactttagtgacaacgagagtgcccggctggccacggac
gccctcttggatgggggttctgaagcctactggcgggtgctcagccaggaaggcgaggtg
gacttcttgtcctcggtggaggcccagtacatccaggcccaggccagggagcccccgtgt
cccccagacaccctgggaggggcggaagcaggccctaagggactggactccagctcccta
cagtccggcacctacttccctgtggcctcagagggcagcgagccggccctactgcacagc
tgggcctcagctgagaagccctacctgaaggaaaaatccagcgccactgtgtacttccag
accgtcaagcacaacaacatcagagacctcgtccgccgctgcatcacccggactagccag
gtcctggtcatcctgatggatgtgttcacggatgtggagatcttctgtgacattctagag
gcagccaacaagcgtggggtgttcgtttgtgtgctcctggaccagggaggtgtgaagctc
ttccaggagatgtgtgacaaagtccagatctctgacagtcacctcaagaacatttccatc
cggagtgtggaaggagagatatactgtgccaagtcaggcaggaaattcgctggccaaatc
cgggagaagttcatcatctcggactggagatttgtcctgtctggatcttacagcttcacc
tggctctgcggacacgtgcaccggaacatcctctccaagttcacaggccaggcggtggag
ctgtttgacgaggagttccgccacctctacgcctcctccaagcctgtgatgggcctgaag
tccccgcggctggtcgcccccgtcccgcccggagcagccccggccaatggccgccttagc
agcagcagtggctccgccagtgaccgcacgtcctccaaccccttcagcggccgctcggca
ggcagccaccccggtacccgaagtgtgtccgcgtcttcagggccctgtagccccgcggcc
ccacacccgcctccaccgccccggttccagccccaccaaggcccttggggagccccgagt
ccccaggcccacctctccccgcggccccacgacggcccgcccgccgctgtctacagcaac
ctgggggcctacaggcccacgcggctgcagctggagcagctgggcctggtgccgaggctg
actccaacctggaggcccttcctgcaggcctcccctcacttctga

DBGET integrated database retrieval system