KEGG   Homo sapiens (human): 84986Help
Entry
84986             CDS       T01001                                 

Gene name
ARHGAP19
Definition
(RefSeq) Rho GTPase activating protein 19
  KO
K20640  Rho GTPase-activating protein 19
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84986 (ARHGAP19)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    84986 (ARHGAP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP Endonuc-dimeris HeH
Motif
Other DBs
NCBI-GeneID: 84986
NCBI-ProteinID: NP_116289
OMIM: 611587
HGNC: 23724
Ensembl: ENSG00000213390
Vega: OTTHUMG00000018845
Pharos: Q14CB8(Tdark)
UniProt: Q14CB8
Position
10q24.1
AA seq 494 aa AA seqDB search
MATEAQSEGEVPARESGRSDAICSFVICNDSSLRGQPIIFNPDFFVEKLRHEKPEIFTEL
VVSNITRLIDLPGTELAQLMGEVDLKLPGGAGPASGFFRSLMSLKRKEKGVIFGSPLTEE
GIAQIYQLIEYLHKNLRVEGLFRVPGNSVRQQILRDALNNGTDIDLESGEFHSNDVATLL
KMFLGELPEPLLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNR
NLLKLLLDLLYQTAKKQDKNKMSAYNLALMFAPHVLWPKNVTANDLQENITKLNSGMAFM
IKHSQKLFKAPAYIRECARLHYLGSRTQASKDDLDLIASCHTKSFQLAKSQKRNRVDSCP
HQEETQHHTEEALRELFQHVHDMPESAKKKQLIRQFNKQSLTQTPGREPSTSQVQKRARS
RSFSGLIKRKVLGNQMMSEKKKKNPTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRL
KWSEGKKEGKKGFL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaggcacagagtgaaggggaggtgccagcccgcgaatccggccggagtgat
gccatctgcagttttgtgatctgcaatgattcttcccttcgaggtcagcccattatcttt
aatcctgacttttttgtggagaaactccgacatgagaaacctgagattttcactgagttg
gtggtcagcaatatcacaaggctcatcgatttacctggaactgagttggctcagctgatg
ggggaagtggaccttaagttgcctggcggggctggcccagcatcaggattcttccggtct
ctcatgtctctcaagcgaaaggaaaaaggagtgatatttgggtccccactgacggaggaa
ggcattgcccagatataccaactgattgagtatctacacaaaaacttgcgagtagagggt
ttgtttagagtaccgggtaatagtgtccgacagcagattttaagggatgctctcaataat
ggaactgacattgacttggaatcaggggaatttcactcaaatgatgttgccactttgctg
aagatgtttctaggagagttgccggagcctctgctgacacataaacacttcaatgcacac
ctcaaaatcgctgatttgatgcagtttgatgataaaggaaacaagaccaatataccagac
aaggaccggcaaattgaggctctccagttgctcttcctcattctccctcctcctaatcgt
aatttgctgaagttattgcttgatctcctataccagacagcaaagaaacaagacaagaac
aagatgtcagcctataaccttgcccttatgtttgcaccccatgtcctgtggccaaaaaat
gtcactgcaaatgaccttcaggagaatatcacaaagttaaacagtgggatggcttttatg
attaaacactcccagaaactttttaaggctcctgcttacattcgggagtgtgcgagattg
cactatttgggatccagaactcaggcatcaaaggatgaccttgacctcatagcttcatgt
catactaagtcctttcagctggcaaagtctcagaaacggaaccgggtagattcctgccct
caccaggaggagacccagcaccatacggaagaggcactgagagagctgtttcaacacgtt
catgatatgccagagtcagcaaagaagaaacaacttattagacagtttaataagcaatca
ttgacccagacaccagggcgagaaccttctacttcccaggtacaaaagagggctcgttcg
cgctccttcagtgggcttattaagcggaaggtcctgggaaatcagatgatgtcagaaaag
aaaaagaagaaccctactccagaatctgtggccattggtgaattgaagggaaccagcaaa
gaaaataggaacttattattttctggctctccagctgtcacgatgacaccaacaagattg
aagtggtctgaagggaagaaagaggggaaaaaaggatttctctga

DBGET integrated database retrieval system