KEGG   Homo sapiens (human): 84993Help
Entry
84993             CDS       T01001                                 

Gene name
UBL7, BMSC-UbP, TCBA1
Definition
(RefSeq) ubiquitin like 7
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin UBA UBA_4 Rad60-SLD Ubiquitin_5 Ubiquitin_2
Motif
Other DBs
NCBI-GeneID: 84993
NCBI-ProteinID: NP_001273668
OMIM: 609748
HGNC: 28221
Ensembl: ENSG00000138629
Vega: OTTHUMG00000139001
Pharos: Q96S82(Tdark)
UniProt: Q96S82
Position
15q24.1
AA seq 380 aa AA seqDB search
MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPEL
IDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTAL
HSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVP
AHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNT
RSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGT
SPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRAL
QATGGDIQAALELIFAGGAP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctcagactggcacctggcggtgaagctggctgaccagccacttactccaaag
tctattcttcggttgccagagacagaactgggagaatactcgctagggggctatagtatt
tcatttctgaagcagcttattgctggcaaactccaggagtctgttccagaccctgagctg
attgatctgatctactgtggtcggaagctaaaagatgaccagacacttgacttctatggc
attcaacctgggtccactgtccatgttctgcgaaagtcctggcctgaacctgatcagaaa
ccggaacctgtggacaaagtggctgccatgagagagttccgggtgttgcacactgccctg
cacagcagctcctcttacagggaggcggtctttaagatgctcagcaataaggagtctctg
gatcagatcattgtggccaccccaggcctcagcagtgaccctattgctcttggggttctc
caggacaaggacctcttctctgtcttcgctgatcccaatatgcttgatacgttggtgcct
gctcacccagccctcgtcaatgccattgtcctggttctgcactccgtagcaggcagtgcc
ccaatgcctgggactgactcctcttcccggagcatgccctccagctcataccgggatatg
ccaggtggcttcctgtttgaagggctctcagatgatgaggatgactttcacccaaacacc
aggtccacaccctctagcagtactcccagctcccgcccagcctccctggggtacagtgga
gctgctgggccccggcccatcacccagagtgagctggccaccgccttggccctggccagc
actccggagagcagctctcacacaccgactcctggcacccagggtcattcctcagggacc
tcaccaatgtcctctggtgtccagtcagggacgcccatcaccaatgatctcttcagccaa
gccctacagcatgcccttcaggcctctgggcagcccagccttcagagccagtggcagccc
cagctgcagcagctacgtgacatgggcatccaggacgatgagctgagcctgcgggccctg
caggccaccggtggggacatccaagcagccctggagctcatctttgctggaggagcccca
tga

DBGET integrated database retrieval system