KEGG   Homo sapiens (human): 8500
Entry
8500              CDS       T01001                                 

Gene name
PPFIA1, LIP.1, LIP1, LIPRIN
Definition
(RefSeq) PTPRF interacting protein alpha 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: SAM_1 SAM_2
Other DBs
NCBI-GeneID: 8500
NCBI-ProteinID: NP_003617
OMIM: 611054
HGNC: 9245
Ensembl: ENSG00000131626
Vega: OTTHUMG00000167266
Pharos: Q13136(Tbio)
UniProt: Q13136 B3KVS8
Position
11q13.3
AA seq 1202 aa
MMCEVMPTISEAEGPPGGGGGHGSGSPSQPDADSHFEQLMVSMLEERDRLLDTLRETQET
LALTQGKLHEVGHERDSLQRQLNTALPQEFAALTKELNVCREQLLEREEEIAELKAERNN
TRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRE
RLRVALERCSLLEEELGATHKELMILKEQNNQKKTLTDGVLDINHEQENTPSTSGKRSSD
GSLSHEEDLAKVIELQEIISKQSREQSQMKERLASLSSHVTELEEDLDTARKDLIKSEEM
NTKLQRDVREAMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEIANKDSMHRQT
EDKNRQLQERLELAEQKLQQTLRKAETLPEVEAELAQRVAALSKAEERHGNIEERLRQME
AQLEEKNQELQRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNSLL
REVESAKKQLEETQHDKDQLVLNIEALRAELDHMRLRGASLHHGRPHLGSVPDFRFPMAD
GHTDSYSTSAVLRRPQKGRLAALRDEPSKVQTLNEQDWERAQQASVLANVAQAFESDADV
SDGEDDRDTLLSSVDLLSPSGQADAHTLAMMLQEQLDAINKEIRLIQEEKENTEQRAEEI
ESRVGSGSLDNLGRFRSMSSIPPYPASSLASSSPPGSGRSTPRRIPHSPAREVDRLGVMT
LLPPSREEVRDDKTTIKCETSPPSSPRALRLDRLHKGALHTVSHEDIRDIRNSTGSQDGP
VSNPSSSNSSQDSLHKAPKKKGIKSSIGRLFGKKEKGRPGQTGKEALGQAGVSETDNSSQ
DALGLSKLGGQAEKNRKLQKKHELLEEARRQGLPFAQWDGPTVVVWLELWVGMPAWYVAA
CRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYG
DMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCG
IMCLRRLNYDRKELERKREESQSEIKDVLVWSNDRVIRWILSIGLKEYANNLIESGVHGA
LLALDETFDFSALALLLQIPTQNTQARAVLEREFNNLLVMGTDRRFDEDDDKSFRRAPSW
RKKFRPKDIRGLAAGSAETLPANFRVTSSMSSPSMQPKKMQMDGNVSGTQRLDSATVRTY
SC
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgatgtgcgaggtgatgccgaccatcagcgaagcagaaggcccccctggaggaggtgga
ggccatggttccggctccccttcacagccagatgcagattcacattttgaacagttgatg
gtctccatgctagaagaaagggaccgccttcttgatacactgagagagactcaagaaacg
ctggccttaacccaggggaagttacacgaggttggtcatgaaagagattccttgcagaga
cagctcaacacggcacttccacaggagttcgcagcacttactaaagaactcaatgtatgc
agggaacagctccttgaaagggaagaagaaattgctgaactgaaagcagaaaggaataac
accaggctgctgttagagcatttggaatgccttgtctccaggcatgagcggtctcttagg
atgaccgtggtgaagagacaagcgcagtctccagcaggcgtgtccagcgaagtggaagtg
ctgaaagcactgaagtccttatttgaacaccacaaagctctggatgaaaaggtgagagag
cgattacgagtagcacttgaaagatgtagtttgttagaagaggaattaggtgccacacac
aaagagctaatgattcttaaagaacagaataatcagaaaaaaactctaacagatggagtg
ctggacataaaccatgaacaagaaaatacaccaagcacgagtggaaagagatcttctgat
ggttctttaagccacgaggaagaccttgctaaagtaattgagctccaagaaatcataagt
aagcagtcaagggaacagagccaaatgaaagaacgcctggcttccctttccagtcatgtg
acagaactggaagaggatctggacacggctagaaaagatctcatcaaatctgaagaaatg
aacacaaaattgcaacgagatgtccgtgaagccatggcccaaaaggaagatatggaagag
agaatcactactcttgaaaaacgctacctcgctgcacagcgtgaagccacatctgtgcat
gacctcaatgataaacttgaaaatgaaattgcaaataaagattctatgcatcgacagact
gaagataaaaaccgccagttacaggagcgcttggaattggcagagcaaaagctgcaacag
acactgaggaaggcagagacgctcccggaggtggaggcggagctggcccagagggtggca
gcgctttccaaggctgaagagagacacggcaacattgaagaaaggttacgacagatggaa
gcacagttggaggagaagaatcaagaactgcagcgggcaaggcaaagagaaaaaatgaac
gaagaacataataaacgtttatcagacactgttgacaagctgctttcagaatctaatgag
aggcttcaacttcatcttaaagagagaatggctgctttggaagataagaactctctttta
agagaagttgaaagtgcaaaaaagcagttagaagaaacacaacacgataaggatcagctt
gtcctaaacattgaagcactgagggctgaactagaccacatgagactaagaggtgcttca
cttcatcatggccgaccccacttgggcagtgtcccagatttcaggttccccatggcagac
ggccacacagactcctacagcaccagtgcagtgctgcggcgcccacagaaaggccggctg
gcagccctgcgagatgagccttccaaggtacaaactcttaatgagcaggattgggaacgt
gcccagcaagctagtgtcttggcaaatgtagcacaagcattcgagagtgatgctgacgtg
tctgatggtgaagatgacagggacactctcctcagctcagttgacctgctatcgcccagc
gggcaggccgacgcgcacacactagccatgatgcttcaggagcagctggacgccatcaac
aaagagatcaggttgattcaggaagaaaaagaaaatacagagcagcgggcagaggagatt
gaaagtcgagttggcagtggaagtctagacaatcttggtcgttttagatcaatgagctcc
attcccccctaccctgcttcctcgcttgctagctcctcccctccgggcagtgggcgctcc
accccacgaaggatccctcacagcccagctcgggaagtggacagactgggcgtcatgacc
cttttgccaccttccagagaagaggtacgagatgacaagacaaccataaagtgtgaaacc
tccccgccttcctccccgagagcccttcggttagaccggctgcacaaaggggcgctgcac
accgtcagccacgaggacatcagggacataaggaactccacaggctcccaggatggtccc
gtgagcaaccccagcagtagcaacagtagccaggactcgctccacaaagccccaaagaag
aaaggcattaagtcctccattggccgcttgtttggcaagaaagaaaagggccgacctgga
caaactggcaaagaagcattaggacaagctggtgtttccgagacggataactcatctcag
gatgccttgggacttagcaaattggggggacaggctgaaaaaaatcgtaaacttcaaaaa
aagcatgaattgctggaggaagcccggagacaaggtttaccttttgcccaatgggacggg
ccaacggttgtggtctggctagagctctgggttgggatgccagcctggtatgtggctgcc
tgccgagcaaacgtgaaaagcggggccatcatgtcggccctgtccgacacagagatccag
cgtgagattggcatcagcaaccccctgcacaggctgaagctgaggctggccatccaggag
atcatgtcgctgaccagcccgtctgccccgcccacatctagaacgacactcgcctatggg
gacatgaaccacgagtggatcggcaacgagtggctccccagcctgggcctcccccagtac
cgcagctacttcatggagtgccttgtagacgccaggatgctggaccacttgaccaagaaa
gaccttcgagggcagctgaaaatggtcgacagttttcacagaaacagtttccagtgtgga
attatgtgcctgagaaggttaaattatgaccggaaagaactggaaagaaaaagagaagaa
agtcagagtgaaataaaagacgtgcttgtttggagcaatgatcgagtgattcgctggatc
ctgtcaattggccttaaagaatatgcaaacaatcttatagagagtggtgttcacggagca
cttctggccttagatgaaaccttcgacttcagtgcactggcactgctgttacagatcccg
acgcagaacacacaggctcgtgctgtcttggaaagagaatttaacaaccttttggtcatg
gggactgatagaaggtttgatgaagatgatgataaaagctttaggagagcaccttcatgg
agaaaaaagtttagaccaaaggacattcgtggcttagctgctgggtcagcagagactctc
cctgcaaacttccgggtgacttcttctatgtcttccccctctatgcagccaaagaagatg
cagatggacggcaatgtatcaggaacacagaggttggattctgctacagtcaggacttac
tcctgctaa

DBGET integrated database retrieval system