KEGG   Homo sapiens (human): 8501Help
Entry
8501              CDS       T01001                                 

Gene name
SLC43A1, LAT3, PB39, POV1, R00504
Definition
(RefSeq) solute carrier family 43 member 1
  KO
K08228  MFS transporter, LAT3 family, solute carrier family 43, member 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    8501 (SLC43A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC43: Na+-independent, system-L-like amino acid transporter
   8501 (SLC43A1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   L-Amino acid transporter-3 (LAT3) family (SLC43 family) [TC:2.A.1.44]
    8501 (SLC43A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 8501
NCBI-ProteinID: NP_001185739
OMIM: 603733
HGNC: 9225
Ensembl: ENSG00000149150
Vega: OTTHUMG00000167030
Pharos: O75387(Tbio)
UniProt: O75387 A0A024R4Y3
Position
11q12.1
AA seq 559 aa AA seqDB search
MAPTLQQAYRRRWWMACTAVLENLFFSAVLLGWGSLLIILKNEGFYSSTCPAESSTNTTQ
DEQRRWPGCDQQDEMLNLGFTIGSFVLSATTLPLGILMDRFGPRPVRLVGSACFTASCTL
MALASRDVEALSPLIFLALSLNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAI
TFPGIKLIYDAGVAFVVIMFTWSGLACLIFLNCTLNWPIEAFPAPEEVNYTKKIKLSGLA
LDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLC
SPTFLWSLLTMGMTQLRIIFYMAAVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFG
AMQLLCLLTCPLIGYIMDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQKLTNAI
SAFTLTNLLLVGFGITCLINNLHLQFVTFVLHTIVRGFFHSACGSLYAAVFPSNHFGTLT
GLQSLISAVFALLQQPLFMAMVGPLKGEPFWVNLGLLLFSLLGFLLPSYLFYYRARLQQE
YAANGMGPLKVLSGSEVTA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcccccacgctgcaacaggcgtaccggaggcgctggtggatggcctgcacggctgtg
ctggagaacctcttcttctctgctgtactcctgggctggggctccctgttgatcattctg
aagaacgagggcttctattccagcacgtgcccagctgagagcagcaccaacaccacccag
gatgagcagcgcaggtggccaggctgtgaccagcaggacgagatgctcaacctgggcttc
accattggttccttcgtgctcagcgccaccaccctgccactggggatcctcatggaccgc
tttggcccccgacccgtgcggctggttggcagtgcctgcttcactgcgtcctgcaccctc
atggccctggcctcccgggacgtggaagctctgtctccgttgatattcctggcgctgtcc
ctgaatggctttggtggcatctgcctaacgttcacttcactcacgctgcccaacatgttt
gggaacctgcgctccacgttaatggccctcatgattggctcttacgcctcttctgccatt
acgttcccaggaatcaagctgatctacgatgccggtgtggccttcgtggtcatcatgttc
acctggtctggcctggcctgccttatctttctgaactgcaccctcaactggcccatcgaa
gcctttcctgcccctgaggaagtcaattacacgaagaagatcaagctgagtgggctggcc
ctggaccacaaggtgacaggtgacctcttctacacccatgtgaccaccatgggccagagg
ctcagccagaaggcccccagcctggaggacggttcggatgccttcatgtcaccccaggat
gttcggggcacctcagaaaaccttcctgagaggtctgtccccttacgcaagagcctctgc
tcccccactttcctgtggagcctcctcaccatgggcatgacccagctgcggatcatcttc
tacatggctgctgtgaacaagatgctggagtaccttgtgactggtggccaggagcatgag
acaaatgaacagcaacaaaaggtggcagagacagttgggttctactcctccgtcttcggg
gccatgcagctgttgtgccttctcacctgccccctcattggctacatcatggactggcgg
atcaaggactgcgtggacgccccaactcagggcactgtcctcggagatgccagggacggg
gttgctaccaaatccatcagaccacgctactgcaagatccaaaagctcaccaatgccatc
agtgccttcaccctgaccaacctgctgcttgtgggttttggcatcacctgtctcatcaac
aacttacacctccagtttgtgacctttgtcctgcacaccattgttcgaggtttcttccac
tcagcctgtgggagtctctatgctgcagtgttcccatccaaccactttgggacgctgaca
ggcctgcagtccctcatcagtgctgtgttcgccttgcttcagcagccacttttcatggcg
atggtgggacccctgaaaggagagcccttctgggtgaatctgggcctcctgctattctca
ctcctgggattcctgttgccttcctacctcttctattaccgtgcccggctccagcaggag
tacgccgccaatgggatgggcccactgaaggtgcttagcggctctgaggtgaccgcatag

DBGET integrated database retrieval system