KEGG   Homo sapiens (human): 85012Help
Entry
85012             CDS       T01001                                 

Gene name
TCEAL3, WEX8
Definition
(RefSeq) transcription elongation factor A like 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: BEX
Motif
Other DBs
NCBI-GeneID: 85012
NCBI-ProteinID: NP_001006934
HGNC: 28247
Ensembl: ENSG00000196507
Vega: OTTHUMG00000022106
Pharos: Q969E4(Tdark)
UniProt: Q969E4
Position
Xq22.2
AA seq 200 aa AA seqDB search
MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQL
EDEGSQEKQGRSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDD
SPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRG
VRGVRGGGRGQRGLHDIPYL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaccctacaataaaaatgaaggaaacctggaaaacgagggaaagccagaagat
gaagtagagcctgatgatgaaggaaagtcagacgaggaagaaaagccagacgtggagggg
aagacagaatgcgagggaaagagagaggatgagggagagccaggtgatgagggacaactg
gaagatgagggaagccaggaaaagcagggcaggtccgaaggtgagggcaagccacaaggc
gagggcaagccagcctcccaggcaaagccagagagccagccgcgggccgccgaaaagcgc
ccggctgaagattatgtgccccggaaagcaaaaagaaaaacggacagggggacggacgat
tcccccaaggactctcaggaggacttacaggaaaggcatctgagcagtgaggagatgatg
agagaatgtggagatgtgtcaagggctcaagaggagctaaggaaaaaacagaaaatgggt
ggttttcattggatgcaaagagatgtacaggatccattcgccccaaggggacaacggggt
gtcaggggagtgaggggtggaggtaggggccagaggggcttacacgatatcccatacctt
taa

DBGET integrated database retrieval system