KEGG   Homo sapiens (human): 8502Help
Entry
8502              CDS       T01001                                 

Gene name
PKP4, p0071
Definition
(RefSeq) plakophilin 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT_2 HEAT
Motif
Other DBs
NCBI-GeneID: 8502
NCBI-ProteinID: NP_003619
OMIM: 604276
HGNC: 9026
Ensembl: ENSG00000144283
Vega: OTTHUMG00000153969
Pharos: Q99569(Tbio)
UniProt: Q99569
Position
2q24.1
AA seq 1192 aa AA seqDB search
MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQ
IVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQPNNYLIRTEP
EQGTLYSPEQTSLHESEGSLGNSRSSTQMNSYSDSGYQEAGSFHNSQNVSKADNRQQHSF
IGSTNNHVVRNSRAEGQTLVQPSVANRAMRRVSSVPSRAQSPSYVISTGVSPSRGSLRTS
LGSGFGSPSVTDPRPLNPSAYSSTTLPAARAASPYSQRPASPTAIRRIGSVTSRQTSNPN
GPTPQYQTTARVGSPLTLTDAQTRVASPSQGQVGSSSPKRSGMTAVPQHLGPSLQRTVHD
MEQFGQQQYDIYERMVPPRPDSLTGLRSSYASQHSQLGQDLRSAVSPDLHITPIYEGRTY
YSPVYRSPNHGTVELQGSQTALYRTGSVGIGNLQRTSSQRSTLTYQRNNYALNTTATYAE
PYRPIQYRVQECNYNRLQHAVPADDGTTRSPSIDSIQKDPREFAWRDPELPEVIHMLQHQ
FPSVQANAAAYLQHLCFGDNKVKMEVCRLGGIKHLVDLLDHRVLEVQKNACGALRNLVFG
KSTDENKIAMKNVGGIPALLRLLRKSIDAEVRELVTGVLWNLSSCDAVKMTIIRDALSTL
TNTVIVPHSGWNNSSFDDDHKIKFQTSLVLRNTTGCLRNLSSAGEEARKQMRSCEGLVDS
LLYVIHTCVNTSDYDSKTVENCVCTLRNLSYRLELEVPQARLLGLNELDDLLGKESPSKD
SEPSCWGKKKKKKKRTPQEDQWDGVGPIPGLSKSPKGVEMLWHPSVVKPYLTLLAESSNP
ATLEGSAGSLQNLSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMA
LDVRNKELIGKYAMRDLVNRLPGGNGPSVLSDETMAAICCALHEVTSKNMENAKALADSG
GIEKLVNITKGRGDRSSLKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQNHFITPVSTLER
DRFKSHPSLSTTNQQMSPIIQSVGSTSSSPALLGIRDPRSEYDRTQPPMQYYNSQGDATH
KGLYPGSSKPSPIYISSYSSPAREQNRRLQHQQLYYSQDDSNRKNFDAYRLYLQSPHSYE
DPYFDDRVHFPASTDYSTQYGLKSTTNYVDFYSTKRPSYRAEQYPGSPDSWV
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atgccagctcctgagcaggcctcattggtggaggaggggcaaccacagacccgccaggaa
gctgcctccactggcccaggcatggaacccgagaccacagccaccactattctagcatcc
gtgaaggagcaggagcttcagtttcagcgactcacccgagaactggaagtggaaaggcag
attgttgccagtcagctagaaagatgtaggcttggagcagaatcaccaagcatcgccagc
accagctcaactgagaagtcatttccttggagatcaacagacgtgccaaatactggtgta
agcaaacctagagtttctgacgctgtccagcccaacaactatctcatcaggacagagcca
gaacaaggaaccctctattcaccagaacagacatctctccatgaaagtgagggatcattg
ggtaactcaagaagttcaacacaaatgaattcttattccgacagtggataccaggaagca
gggagtttccacaacagccagaacgtgagcaaggcagacaacagacagcagcattcattc
ataggatcaactaacaaccatgtggtgaggaattcaagagctgaaggacaaacactggtt
cagccatcagtagccaatcgggccatgagaagagttagttcagttccatctagagcacag
tctccttcttatgttatcagcacaggcgtgtctccttcaagggggtctctgagaacttct
ctgggtagtggatttggctctccgtcagtgaccgacccccgacctctgaaccccagtgca
tattcctccaccacattacctgctgcacgggcagcctctccgtactcacagagacccgcc
tccccaacagctatacggcggattgggtcagtcacctcccggcagacctccaatcccaac
ggaccaacccctcaataccaaaccaccgccagagtggggtccccactgaccctgacggat
gcacagactcgagtagcttccccatcccaaggccaggtggggtcgtcgtcccccaaacgc
tcagggatgaccgccgtaccacagcatctgggaccttcactgcaaaggactgttcatgac
atggagcaattcggacagcagcagtatgacatttatgagaggatggttccacccaggcca
gacagcctgacaggcttacggagttcctatgctagtcagcatagtcagcttgggcaagac
cttcgttctgccgtgtctcccgacttgcacattactcctatatatgaggggaggacctat
tacagcccagtgtaccgcagcccaaaccatggaactgtggagctccaaggatcgcagacg
gcgttgtatcgcacaggttcagtaggtattggaaatctacaaaggacatccagccaacga
agtacccttacataccaaagaaataattatgctctgaacacaacagctacctacgcggag
ccctacaggcctatacaataccgagtgcaagagtgcaattataacaggcttcagcatgca
gtgccggctgatgatggcaccacaagatccccatcaatagacagcattcagaaggacccc
agggagtttgcctggcgtgatcctgagttgcctgaggtcattcacatgcttcagcaccag
ttcccatctgttcaggcaaatgcagcggcctacctgcagcacctgtgctttggtgacaac
aaagtgaagatggaggtgtgtaggttagggggaatcaagcatctggttgaccttctggac
cacagagttttggaagttcagaagaatgcttgtggtgcccttcgaaacctcgtttttggc
aagtctacagatgaaaataaaatagcaatgaagaatgttggtgggatacctgccttgttg
cgactgttgagaaaatctattgatgcagaagtaagggagcttgttacaggagttctttgg
aatttatcctcatgtgatgctgtaaaaatgacaatcattcgagatgctctctcaacctta
acaaacactgtgattgttccacattctggatggaataactcttcttttgatgatgatcat
aaaattaaatttcagacttcactagttctgcgtaacacgacaggttgcctaaggaacctc
agctccgcgggggaagaagctcggaagcaaatgcggtcctgcgaggggctggtagactca
ctgttgtatgtgatccacacgtgtgtgaacacatccgattacgacagcaagacggtggag
aactgcgtgtgcaccctgaggaacctgtcctatcggctggagctggaggtgccccaggcc
cggttactgggactgaacgaattggatgacttactaggaaaagagtctcccagcaaagac
tctgagccaagttgctgggggaagaagaagaaaaagaaaaagaggactccgcaagaagat
caatgggatggagttggtcctatcccaggactgtcgaagtcccccaaaggggttgagatg
ctgtggcacccatcggtggtaaaaccatatctgactcttctagcagaaagttccaaccca
gccaccttggaaggctctgcagggtctctccagaacctctctgctggcaactggaagttt
gcagcatatatccgggcggccgtccgaaaagaaaaggggctccccatccttgtggagctt
ctgagaatggataacgatagagttgtttcttccgtggcaacagccttgaggaatatggca
ctagatgttcgcaacaaggagctcataggcaaatacgccatgcgagacctggtcaaccgg
ctccccggcggcaatggccccagtgtcttgtctgatgagaccatggcagccatctgctgt
gctctgcacgaggtcaccagcaaaaacatggagaacgcaaaagccctggccgactcagga
ggcatagagaagctggtgaacataaccaaaggcaggggcgacagatcatctctgaaagtg
gtgaaggcagcagcccaggtcttgaatacattatggcaatatcgggacctccggagcatt
tataaaaaggatgggtggaatcagaaccattttattacacctgtgtcgacattggagcga
gaccgattcaaatcacatccttccttgtctaccaccaaccaacagatgtcacccatcatt
cagtcagtcggcagcacctcttcctcaccagcactgttaggaatcagagaccctcgctct
gaatacgataggacccagccacctatgcagtattacaatagccaaggggatgccacacat
aaaggcctgtaccctggctccagcaaaccttcaccaatttacatcagttcctattcctca
ccagcaagagaacaaaatagacggctacagcatcaacagctgtattatagtcaagatgac
tccaacagaaagaactttgatgcatacagattgtatttgcagtctcctcatagctatgaa
gatccttattttgatgaccgagttcactttccagcttctactgattactcaacacagtat
ggactgaaatcgaccacaaattatgtagacttttattccactaaacgaccttcttataga
gcagaacagtacccagggtccccagactcatgggtgtag

DBGET integrated database retrieval system