KEGG   Homo sapiens (human): 8513
Entry
8513              CDS       T01001                                 

Gene name
LIPF, GL, HGL, HLAL
Definition
(RefSeq) lipase F, gastric type
  KO
K14452  gastric triacylglycerol lipase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Drug target
Orlistat: D04028
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8513 (LIPF)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    8513 (LIPF)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     8513 (LIPF)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydro_lipase Hydrolase_4 Abhydrolase_6 Esterase
Other DBs
NCBI-GeneID: 8513
NCBI-ProteinID: NP_004181
OMIM: 601980
HGNC: 6622
Ensembl: ENSG00000182333
Vega: OTTHUMG00000018695
Pharos: P07098(Tclin)
UniProt: P07098
Structure
PDB: 
1HLG

Position
10q23.31
AA seq 398 aa
MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILE
VNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRG
NTWARRNLYYSPDSVEFWAFSFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFI
AFSTNPSLAKRIKTFYALAPVATVKYTKSLINKLRFVPQSLFKFIFGDKIFYPHNFFDQF
LATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPAGTSVQNMFHWTQAVKS
GKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPN
LIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtggctgcttttaacaatggcaagtttgatatctgtactggggactacacatggtttg
tttggaaaattacatcctggaagccctgaagtgactatgaacattagtcagatgattact
tattggggatacccaaatgaagaatatgaagttgtgactgaagatggttatattcttgaa
gtcaatagaattccttatgggaagaaaaattcagggaatacaggccagagacctgttgtg
tttttgcagcatggtttgcttgcatcagccacaaactggatttccaacctgccgaacaac
agccttgccttcattctggcagatgctggttatgatgtgtggctgggcaacagcagagga
aacacctgggccagaagaaacttgtactattcaccagattcagttgaattctgggctttc
agctttgatgaaatggctaaatatgaccttccagccacaatcgacttcattgtaaagaaa
actggacagaagcagctacactatgttggccattcccagggcaccaccattggttttatt
gccttttccaccaatcccagcctggctaaaagaatcaaaaccttctatgctctagctcct
gttgccactgtgaagtatacaaaaagccttataaacaaacttagatttgttcctcaatcc
ctcttcaagtttatatttggtgacaaaatattctacccacacaacttctttgatcaattt
cttgctactgaagtgtgctcccgtgagatgctgaatctcctttgcagcaatgccttattt
ataatttgtggatttgacagtaagaactttaacacgagtcgcttggatgtgtatctatca
cataatccagcaggaacttctgttcaaaacatgttccattggacccaggctgttaagtct
gggaaattccaagcttatgactggggaagcccagttcagaataggatgcactatgatcag
tcccaacctccctactacaatgtgacagccatgaatgtaccaattgcagtgtggaacggt
ggcaaggacctgttggctgacccccaagatgttggccttttgcttccaaaactccccaat
cttatttaccacaaggagattcctttttacaatcacttggactttatctgggcaatggat
gcccctcaagaagtttacaatgacattgtttctatgatatcagaagataaaaagtag

DBGET integrated database retrieval system