KEGG   Homo sapiens (human): 8516Help
Entry
8516              CDS       T01001                                 

Gene name
ITGA8
Definition
(RefSeq) integrin subunit alpha 8
  KO
K06584  integrin alpha 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H01728  Potter syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    8516 (ITGA8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    8516 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    8516 (ITGA8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    8516 (ITGA8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    8516 (ITGA8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    8516 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    8516 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    8516 (ITGA8)
  Infectious diseases
   05165 Human papillomavirus infection
    8516 (ITGA8)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   8516 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 8516
NCBI-ProteinID: NP_003629
OMIM: 604063
HGNC: 6144
Ensembl: ENSG00000077943
Vega: OTTHUMG00000017733
Pharos: P53708(Tbio)
UniProt: P53708 B4DN28
Position
10p13
AA seq 1063 aa AA seqDB search
MSPGASRGPRGSQAPLIAPLCCAAAALGMLLWSPACQAFNLDVEKLTVYSGPKGSYFGYA
VDFHIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIR
VNGTKEPIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYTVVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQRGKVL
IYNGNKDGLNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLHPMIINLENKTCQVPDSMTSAACFSLRVCASVTGQSIANTIVLMA
EVQLDSLKQKGAIKRTLFLDNHQAHRVFPLVIKRQKSHQCQDFIVYLRDETEFRDKLSPI
NISLNYSLDESTFKEGLEVKPILNYYRENIVSEQAHILVDCGEDNLCVPDLKLSARPDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQIN
ITAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTIL
EVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIP
HLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQ
RKNDPYALASLVSFEVKKMPYTDQPAKLPEGSIVIKTSVIWATPNVSFSIPLWVIILAIL
LGLLVLAILTLALWKCGFFDRARPPQEDMTDREQLTNDKTPEA
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccggggccagccgcggtccccggggaagccaggcgccgctgatcgcgcccctc
tgctgcgccgcggccgcgctggggatgttgctgtggtcccccgcctgtcaggcgttcaac
ctggacgtggaaaagctcacagtgtacagcggccccaagggcagctacttcggctacgcc
gtggacttccacatacccgacgcccgcacagcgagtgtcttggtgggggcgcccaaagcc
aacaccagccagcccgatatcgtggaagggggagccgtctattactgtccttggcccgcg
gaggggtctgcgcagtgcaggcagataccgtttgacaccaccaacaacagaaagatcaga
gttaatggaaccaaagaacctatcgagttcaaatccaatcagtggtttggagcaacagtg
aaagctcacaaaggaaaagttgtggcctgtgctcctttatatcactggagaactcttaaa
ccgacaccagaaaaggacccagttggcacctgctatgtagcaattcagaacttcagcgcc
tatgccgagttctctccttgccggaacagcaatgctgatccggaaggccagggttactgc
caagcaggatttagtctggatttttataagaatggagaccttattgtgggaggacctggg
agtttctactggcaaggacaagtgatcactgccagtgttgcagatatcattgcaaattac
tcattcaaggatatcctcaggaaactggcaggagaaaagcagacggaagtggctccagct
tcctatgatgacagttaccttggatactcagttgctgctggggagtttactggggattct
cagcaagaattggttgctggaattccaagaggagcacagaattttggatatgtttccatc
attaactctacggatatgacgtttattcagaatttcacgggagaacagatggcatcttat
tttggatataccgttgtcgtatcagatgttaacagtgatggactggatgatgtcctggtt
ggggcacctctctttatggaacgtgaatttgagagcaaccccagagaagtagggcaaatc
tacctgtatttgcaagtgagctctctcctcttcagagacccccagatcctcactggcacc
gagacgtttgggagattcggtagtgctatggcacacttaggagacctgaaccaagatgga
tacaatgacattgccatcggagtgccttttgcaggcaaggatcaaagaggcaaagtgctc
atttataatgggaacaaagatggcttaaacaccaagccttcccaagttctgcaaggagtg
tgggcctcacatgctgtcccttccggatttggctttactttaagaggagattcagacata
gacaagaatgattacccagatttgattgtgggtgcatttggaacaggaaaagtcgctgtt
tacagagcaagaccggttgtgactgtagatgcccagcttctgctgcacccaatgattatc
aatcttgaaaataaaacttgccaggttccagactctatgacatctgctgcctgcttttct
ttaagagtatgtgcatctgtcacaggccagagcattgcaaacacaatagtcttgatggca
gaggtgcaattagattccctgaaacagaaaggagctattaaacggacgctcttccttgat
aaccatcaggctcatcgcgtcttccctcttgtgataaaaaggcagaaatcccaccagtgc
caggatttcatcgtttaccttcgagatgaaactgaattccgagataaattatctccaatc
aacattagtttgaattacagtttggacgaatccacctttaaagaaggcctggaagtgaaa
ccaatattgaactactacagagaaaacattgttagtgaacaggctcacattctggtggac
tgtggagaagacaatctgtgtgttcctgacttgaagctgtcggctagaccagataagcat
caggtaatcattggagatgaaaatcaccttatgctcataataaatgcaagaaatgaaggg
gaaggagcatatgaagctgaactctttgtaatgataccagaagaggcagattatgttgga
atcgaacgcaacaacaagggatttcgaccactgagctgtgagtacaagatggaaaatgta
accaggatggtggtgtgtgaccttgggaaccctatggtgtctggaacaaattattccctg
ggcctccgatttgcagttccacgtcttgagaaaacaaacatgagcattaacttcgatctc
caaatcagaagttccaacaaggacaatccagacagcaattttgtgagcctgcaaatcaac
atcactgctgtagcgcaggtggaaataagaggagtgtcacaccctccgcagattgttctg
cccattcataactgggaaccagaagaggagccccacaaagaggaggaggttggaccattg
gtggaacatatttatgagctgcacaatattggaccaagtaccatcagtgacaccatcctg
gaggtgggctggcctttctctgcccgggatgaatttcttctctatattttccatattcaa
actctgggacctctgcagtgccaaccaaatcctaatatcaatccacaggatataaagcct
gctgcctccccagaggacacccctgagctcagcgcctttttgcgaaactctactattcct
catcttgtcaggaagagggatgtacatgtggtcgaattccacagacagagccctgcaaaa
atactgaattgtacaaatatcgagtgtttacaaatctcctgtgcagtgggacgactcgaa
ggaggagaaagcgcagtcctgaaagtcaggtcacgattatgggcccacaccttcctccag
agaaaaaatgatccctatgctcttgcatccctggtgtcctttgaagttaagaagatgcct
tatacagatcagccagcaaaactcccagaaggaagcatagtaattaagacatcagttatt
tgggcaactccgaatgtttccttctcaatcccattatgggtaataatactagcaatactt
cttggattgttggttctcgccattttaaccttagctttatggaagtgtggattctttgac
agagccagacctcctcaggaggacatgaccgacagggaacagctgacaaatgacaagacc
cctgaggcatga

DBGET integrated database retrieval system