KEGG   Homo sapiens (human): 8520Help
Entry
8520              CDS       T01001                                 

Gene name
HAT1, KAT1
Definition
(RefSeq) histone acetyltransferase 1
  KO
K11303  histone acetyltransferase 1 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    8520 (HAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8520 (HAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     8520 (HAT1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    8520 (HAT1)
   HAT complexes
    HATB complex
     8520 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hat1_N Acetyltransf_7 Acetyltransf_10 Acetyltransf_1
Motif
Other DBs
NCBI-GeneID: 8520
NCBI-ProteinID: NP_003633
OMIM: 603053
HGNC: 4821
Ensembl: ENSG00000128708
Vega: OTTHUMG00000132282
Pharos: O14929(Tbio)
UniProt: O14929
Structure
PDB: 

Position
2q31.1
AA seq 419 aa AA seqDB search
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SREKLMQGFNEDMVIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatttggtgctatggagaaatttttggtagaatataagagtgcagtggagaag
aaactggcagagtacaaatgtaacaccaacacagcaattgaactaaaattagttcgtttt
cctgaagatcttgaaaatgacattagaactttctttcctgagtatacccatcaactcttt
ggggatgatgaaactgcttttggttacaagggtctaaagatcctgttatactatattgct
ggtagcctgtcaacaatgttccgtgttgaatatgcatctaaagttgatgagaactttgac
tgtgtagaggcagatgatgttgagggcaaaattagacaaatcattccacctggattttgc
acaaacacgaatgatttcctttctttactggaaaaggaagttgatttcaagccattcgga
accttacttcatacctactcagttctcagtccaacaggaggagaaaactttacctttcag
atatataaggctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcag
atgctgattttgactccatttcaaggtcaaggccatggtgctcaacttcttgaaacagtt
catagatactacactgaatttcctacagttcttgatattacagcggaagatccatccaaa
agctatgtgaaattacgagactttgtgcttgtgaagctttgtcaagatttgccctgtttt
tcccgggaaaaattaatgcaaggattcaatgaagatatggtgatagaggcacaacagaag
ttcaaaataaataagcaacacgctagaagggtttatgaaattcttcgactactggtaact
gacatgagtgatgccgaacaatacagaagctacagactggatattaaaagaagactaatt
agcccatataagaaaaagcagagagatcttgctaagatgagaaaatgtctcagaccagaa
gaactgacaaaccagatgaaccaaatagaaataagcatgcaacatgaacagctggaagag
agttttcaggaactagtggaagattaccggcgtgttattgaacgacttgctcaagagtaa

DBGET integrated database retrieval system