KEGG   Homo sapiens (human): 8526Help
Entry
8526              CDS       T01001                                 

Gene name
DGKE, AHUS7, DAGK5, DAGK6, DGK, NPHS7
Definition
(RefSeq) diacylglycerol kinase epsilon
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Disease
H01657  Nephrotic syndrome
H01726  Membranoproliferative glomerulonephritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8526 (DGKE)
   00564 Glycerophospholipid metabolism
    8526 (DGKE)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8526 (DGKE)
   04072 Phospholipase D signaling pathway
    8526 (DGKE)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8526 (DGKE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     8526 (DGKE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat C1_1
Motif
Other DBs
NCBI-GeneID: 8526
NCBI-ProteinID: NP_003638
OMIM: 601440
HGNC: 2852
Ensembl: ENSG00000153933
Vega: OTTHUMG00000178121
Pharos: P52429(Tbio)
UniProt: P52429 A1L4Q0
Position
17q22
AA seq 567 aa AA seqDB search
MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKH
GWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVL
DAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFG
EFKNLIIPPSYLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEF
RILLNPVQVFDVTKTPPIKALQLCTLLPYYSARVLVCGGDGTVGWVLDAVDDMKIKGQEK
YIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYY
NLRKPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQEC
KDLNKKVELELDGERVALPSLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVV
GVYGSFHCAQIQVKLANPFRIGQAHTVRLILKCSMMPMQVDGEPWAQGPCTVTITHKTHA
MMLYFSGEQTDDDISSTSDQEDIKATE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggagaggcggccggcgccgggctcgccctccgagggcctgtttgcggacggg
cacctgatcttgtggacgctgtgctcggtcctgctgccggtgttcatcaccttctggtgt
agcctccagcggtcgcgccggcagctgcaccgcagggacatcttccgcaagagcaagcac
gggtggcgcgacacggacctgttcagccagcccacctactgctgcgtgtgcgcgcagcac
attctgcagggcgccttctgcgactgctgcgggctccgcgtggacgagggctgcctcagg
aaggccgacaagcgcttccagtgcaaggagattatgctcaagaatgacaccaaggtcctg
gacgccatgccccaccactggatccggggcaacgtgcccctgtgcagttactgtatggtt
tgcaagcagcagtgtggctgtcaacccaagctttgcgattacaggtgcatttggtgccag
aaaacagtacatgatgagtgcatgaaaaatagtttaaagaatgaaaaatgtgattttgga
gaattcaaaaacctaatcattccaccaagttatttaacatccattaatcagatgcgtaaa
gacaaaaaaacagattatgaagtgctagcctctaagcttggaaagcagtggaccccatta
ataatcctggccaactctcgtagtggaactaatatgggagaaggactgttgggagaattt
aggatcttgttgaatccagtccaggtttttgatgtaactaaaactcctcctatcaaagcc
ctacaactctgtactcttctcccatattattcagctcgagtacttgtttgtggaggggat
gggactgtagggtgggtcctggatgcagttgatgacatgaagattaagggacaagaaaag
tacattccacaagttgcagttttgcctctgggaacaggcaacgatctatccaatacattg
ggttggggtacaggttatgctggagaaattccagttgcgcaggttttgcgaaatgtaatg
gaagcagatggaattaaactagatcgatggaaagttcaagtaacaaataaaggatactac
aacttaagaaaacccaaggaattcacaatgaacaactatttttctgttggacctgatgct
ctcatggctctcaattttcatgctcatcgtgagaaggcaccatctctgttttctagcaga
attcttaataaggcggtttacttattctatggaaccaaagattgtttagtgcaagaatgt
aaagatttgaataaaaaagttgagctagaactggatggtgagcgagtagcactgcccagc
ttggaaggtattatagttctgaacatcggatactggggcggtggctgcagactatgggaa
gggatgggggacgagacttaccctctagccaggcatgacgatggtctgctggaagtcgtt
ggagtatatgggtctttccactgtgctcagattcaagtaaaactggctaatccttttcga
ataggacaggcacatacagtgaggctgattttgaagtgctccatgatgccaatgcaggtg
gatggggagccttgggcccaagggccctgcactgtcaccataactcacaagacacatgca
atgatgttatatttctctggagaacaaacagatgatgacatctctagtacttcggatcaa
gaagatataaaggcgactgaatag

DBGET integrated database retrieval system