KEGG   Homo sapiens (human): 8527Help
Entry
8527              CDS       T01001                                 

Gene name
DGKD, DGKdelta, dgkd-2
Definition
(RefSeq) diacylglycerol kinase delta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8527 (DGKD)
   00564 Glycerophospholipid metabolism
    8527 (DGKD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8527 (DGKD)
   04072 Phospholipase D signaling pathway
    8527 (DGKD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8527 (DGKD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     8527 (DGKD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat SAM_2 C1_1 SAM_1 PH PH_3 PH_8 C1_2 Mcp5_PH PH_11 SAM_PNT SAM_3 SBE2
Motif
Other DBs
NCBI-GeneID: 8527
NCBI-ProteinID: NP_690618
OMIM: 601826
HGNC: 2851
Ensembl: ENSG00000077044
Vega: OTTHUMG00000133290
Pharos: Q16760(Tbio)
UniProt: Q16760
Structure
PDB: 

Position
2q37.1
AA seq 1214 aa AA seqDB search
MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTIIKEGML
TKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
CRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDADGIAMPHQWLE
GNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLTKCPLGLCKVSVIPPTA
LNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTVTEDFSEDSEVQQILFY
EDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKCS
VLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSICGSTGDRLVASACPARP
QIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGFVLGLSESEEKMDHRVC
PPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPPQPGSRDGLPALNTKIL
YPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVMNNYFGIGLDAKISLDF
NNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSLQGIAV
LNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIRLQHHRIAQCR
TVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRAFESTLKSWEDKQKCEL
PRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSM
DRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMD
RQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHSSLGA
PVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRILC
GIKELSRSAPAVEA
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcgcccctccgccgggtcccccgcaaccgcctccgccgccgccg
cccgaggagtcgtccgacagcgagcccgaggcggagcccggctccccacagaagctcatc
cgcaaggtgtccacgtcgggtcagatccgacagaagaccatcatcaaagaggggatgctg
accaaacagaacaattcattccagcgatcaaaaaggagatactttaagcttcgagggcga
acgctttactatgccaaaacggcaaagtcaatcatatttgatgaggtggatctgacagat
gccagcgtagctgaatccagtaccaaaaacgtcaacaacagttttacggtcataactcca
tgcaggaagctcatcttgtgtgctgataacagaaaagaaatggaagattggattgcagca
ttaaagactgtgcagaacagggagcactttgagcccacccagtacagcatggaccacttc
tcagggatgcacaattggtacgcctgttcccacgcgaggccgacctactgcaatgtgtgc
cgtgaggctctgtctggggtcacgtcgcacgggctgtcctgcgaggtgtgcaaatttaag
gcccacaagcgctgtgctgtgcgtgcaaccaataactgcaagtggaccacactggcctcg
atcgggaaggacatcattgaagatgcagatgggattgcaatgccccaccagtggttggaa
ggaaacctacctgtgagcgccaagtgcactgtgtgcgacaagacctgtggcagtgtgctg
cgcctgcaggactggcgctgcctctggtgcaaggccatggttcacacatcgtgtaaagaa
tccttgctgaccaagtgcccacttggcctgtgcaaagtgtcagtcatcccacccacggct
ctcaacagcatcgactccgatgggttctggaaggccagctgtcctccttcttgcacaagc
ccactgttggtcttcgtcaattcaaaaagtggggacaaccagggtgtgaagttcctcaga
agattcaaacagctactaaaccccgcccaggtcttcgacctcatgaacggaggcccacac
ctcggcttacggttattccagaagtttgacacattccggattctggtttgtggcggggat
ggaagtgttggctgggtcctctccgaaatcgacagcctcaaccttcataaacagtgtcag
ctgggagtgctgccgctcggcacagggaacgacttggcccgagtactgggctggggctca
gcctgcgatgacgacacccagctcccccagatcttggagaagttggagagagccagcacc
aagatgctggacaggtggagcgtcatggcatacgaggccaagctcccccggcaggcctcc
tcctctaccgtcaccgaagacttcagcgaggattccgaggtacagcagattctcttctat
gaagactcggttgcagcccacctttctaaaatcctcacctcggaccagcactcggtggtc
atctcctcggccaaagtgctctgtgagacggtgaaggacttcgtggcacgggtggggaag
gcctatgagaagacgaccgagagctcggaggagtcagaggtcatggccaagaagtgctct
gtcctgaaagagaagctggattcccttctcaagaccttggacgatgagtcccaggcctcg
tcctctctgcccaacccgccccccaccattgccgaggaggctgaagatggagatgggtcg
ggcagcatctgcggttccaccggagaccgcttggtggcatcagcttgcccggcccggccg
cagatattccggcctcgagaacagctcatgctgagagccaacagcctgaagaaagcaatt
cgtcagatcatagaacacacagaaaaagctgtcgatgagcagaatgcccagacccaggag
caggagggcttcgtcctgggcctctctgagtcagaggagaagatggaccacagagtgtgc
ccaccactgtcccacagcgagagcttcggggtccccaaggggaggagccagcgcaaagtg
tcgaaatctccgtgtgaaaagctgatcagcaaagggagtctgtccctaggcagttctgct
tcccttccgccccagccgggaagccgggacggcctgcctgcgctcaacaccaagatcctg
tacccaaatgtccgggctggaatgtctggttccttacccggtggctcagtcatcagtcgc
ctgttaattaatgctgatcccttcaactctgaaccagaaaccctagagtattacacggag
aaatgtgtcatgaacaactattttggcattggcctggatgcgaagatatccctggacttt
aacaacaagcgcgatgagcacccagagaagtgcaggagccgaaccaagaacatgatgtgg
tatggagttcttggaaccaaagagttgctgcacagaacctacaagaacctggagcaaaag
gtcttgctggagtgtgacgggcgacccatcccactccccagtcttcagggaattgctgtc
cttaacattcccagctatgccggaggaaccaacttctgggggggtaccaaggaagatgat
actttcgcagctccatcattcgatgacaagattctggaggtggtcgccgtgttcggcagc
atgcagatggccgtctctcgagtcatcaggctacagcatcatcggatcgcccagtgtcgc
acggtgaagatctccatccttggggatgagggcgtgcctgtgcaggtggacggagaggcc
tgggtccagccgccagggtacattcggattgtccacaagaaccgggcacagacactgacc
agagacagggcatttgagagcaccctgaagtcctgggaagacaagcagaagtgcgagctg
ccccgccctccatcctgttccctgcacccggagatgctgtccgaggaggaggccacccag
atggaccagtttgggcaggcagcaggggtcctcattcacagtatccgagaaatagctcag
tctcaccgggacatggagcaggaactggcccacgccgtcaatgccagctccaagtccatg
gaccgtgtgtatggcaagcccagaaccacagaggggctcaactgcagcttcgtcctggaa
atggtgaataacttcagagctctgcgcagtgagacggagctgctgctgtctgggaagatg
gccctgcagctggatccgcctcagaaggagcagctggggagtgctcttgccgagatggac
cgacagctcaggaggctggcagacaccccgtggctctgccagtccgcagagcccggcgac
gaagagagtgtgatgctggatcttgccaagcgcagtcgcagtggtaaattccgcctcgtg
accaagtttaaaaaggagaaaaacaacaagaacaaagaagctcacagtagcctgggagcc
ccggttcacctctgggggacagaggaggttgctgcctggctggagcacctcagtctctgt
gagtataaggacatcttcacacggcacgacatccggggctctgagctcctgcacctggag
cggagggacctcaaggacctgggcgtgaccaaggtgggccacatgaagaggatcctgtgt
ggcatcaaggagctgagccgcagcgcccccgccgtcgaggcctag

DBGET integrated database retrieval system