KEGG   Homo sapiens (human): 8528Help
Entry
8528              CDS       T01001                                 

Gene name
DDO, DASOX, DDO-1, DDO-2
Definition
(RefSeq) D-aspartate oxidase
  KO
K00272  D-aspartate oxidase [EC:1.4.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    8528 (DDO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8528 (DDO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.1  D-aspartate oxidase
     8528 (DDO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO NAD_binding_8 Pyr_redox Thi4 Pyr_redox_2 UDPG_MGDP_dh_N AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 8528
NCBI-ProteinID: NP_004023
OMIM: 124450
HGNC: 2727
Ensembl: ENSG00000203797
Vega: OTTHUMG00000015360
Pharos: Q99489(Tchem)
UniProt: Q99489
Position
6q21
AA seq 282 aa AA seqDB search
MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTP
IHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGIKGSGGWTLTRRIEDLWELHPSFDIV
VNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQK
GDWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLP
VVHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggacacagcacggattgcagttgtcggggcaggtgtggtggggctctccacggctgtg
tgcatctccaaactggtgccccgatgctccgttaccatcatttcagacaagtttactcca
gataccaccagtgatgtggcagccggaatgcttattcctcacacttatccagatacaccc
attcacacgcagaagcagtggttcagagaaacctttaatcacctctttgcaattgccaat
tctgcagaagctggagatgctggtgttcatttggtatcagggataaagggaagtggaggc
tggacactcactcggcgaatagaagacctgtgggaacttcatccgtcctttgacatcgtg
gtcaactgttcaggccttggaagcagacagcttgcaggagactcaaagattttccctgta
aggggccaagtcctccaagttcaggctccctgggtggagcattttatccgagatggcagt
gggctgacatatatttatcctggtacatcccatgtaaccctaggtggaactaggcaaaaa
ggggactggaatctgtccccggatgcagaaaatagcagagagattctttcccgatgctgt
gctctggagccctccctccacggagcctgcaacatcagggagaaggtgggcttgaggccc
tacaggccaggcgtgcgactgcagacagagctccttgcgcgagatggacagaggctgcct
gtagtccaccactatggccatgggagtgggggcatctcagtgcactggggcactgctctg
gaggccgccaggctggtgagcgagtgtgtccatgccctcaggacccccattcccaagtca
aacctgtag

DBGET integrated database retrieval system