KEGG   Homo sapiens (human): 85290
Entry
85290             CDS       T01001                                 

Gene name
KRTAP4-3, KAP4.3
Definition
(RefSeq) keratin associated protein 4-3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Keratin_B2_2 Keratin_B2
Other DBs
NCBI-GeneID: 85290
NCBI-ProteinID: NP_149443
HGNC: 18908
Ensembl: ENSG00000196156
Vega: OTTHUMG00000133639
Pharos: Q9BYR4(Tbio)
UniProt: Q9BYR4
Position
17q21.2
AA seq 195 aa
MVSSCCGSVCSDQSCGQGLGQESCCRPSCCQTTCCRTTCCRPSCCISSCCRPSCCISSCC
KPSCCRTTCCRPSCCISSCCRPSCCISSCCKPSCCRTTCCRPSCCISSCCRPSCCISSCC
KPSCCQTTCCRPSCCISSCYRPQCCQPSCCRPACCISSCCHPSCCVSSCRCPFSCPTTCC
RTTCFHPICCGSSCC
NT seq 588 nt   +upstreamnt  +downstreamnt
atggtcagctcctgctgtggctctgtctgctctgaccagagctgtggtcaaggtctcggc
caggagagctgctgccgccccagctgctgccagaccacctgctgcaggaccacctgctgc
cgccccagctgctgcatttccagttgctgcaggccttcctgctgtatctccagctgctgc
aaacccagctgctgcaggaccacctgctgccgccccagctgctgcatttccagttgctgc
aggccttcctgctgtatctccagctgctgcaaacccagctgctgcaggaccacctgctgc
cgccccagctgctgcatttctagttgctgcaggccttcctgctgtatctctagctgttgc
aaacccagctgctgccagaccacctgctgccgccccagctgctgtatctccagctgctac
aggccccagtgctgccagccctcctgctgccgcccggcttgctgcatttctagttgctgt
catcccagctgctgtgtgtccagctgccgctgccctttcagctgcccgaccacctgctgt
agaacaacctgcttccaccccatctgctgcggcagttcttgctgctga

DBGET integrated database retrieval system