KEGG   Homo sapiens (human): 85294Help
Entry
85294             CDS       T01001                                 

Gene name
KRTAP2-4, KAP2.1B, KAP2.3, KAP2.4, KRTAP2-3, KRTAP2.3, KRTAP2.4
Definition
(RefSeq) keratin associated protein 2-4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2 Keratin_B2_2
Motif
Other DBs
NCBI-GeneID: 85294
NCBI-ProteinID: NP_149440
HGNC: 18891
Ensembl: ENSG00000213417
Vega: OTTHUMG00000133594
Pharos: P0C7H8(Tdark) Q9BYR9(Tdark)
UniProt: P0C7H8 Q9BYR9
Position
17q21.2
AA seq 128 aa AA seqDB search
MTGSCCGSTLSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRR
PVCCDPCSLQEGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCS
TTCRTSSC
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctcctgctgcggctccaccttgtcctccctgagctacgggggaggctgctgc
cagccctgctgctgccgcgacccctgctgctgccgccccgtgacctgccagaccaccgtg
tgccgccccgtgacctgcgtgccccgctgcacgcgccccatctgcgagccctgccgccgc
ccggtgtgctgcgacccctgctccctgcaggaaggctgctgccgccccatcacctgctgc
ccctcgtcgtgcacggctgtggtgtgcaggccctgctgctgggccaccacctgctgccag
cctgtgtctgtgcagtccccctgctgccggcccccctgcggccagccgaccccttgcagc
accacctgcaggacctcctcctgctga

DBGET integrated database retrieval system