KEGG   Homo sapiens (human): 8530Help
Entry
8530              CDS       T01001                                 

Gene name
CST7, CMAP
Definition
(RefSeq) cystatin F
  KO
K13903  cystatin-F
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin Spp-24 SQAPI Cathelicidins
Motif
Other DBs
NCBI-GeneID: 8530
NCBI-ProteinID: NP_003641
OMIM: 603253
HGNC: 2479
Ensembl: ENSG00000077984
Vega: OTTHUMG00000032108
Pharos: O76096(Tbio)
UniProt: O76096
Structure
PDB: 

Position
20p11.21
AA seq 145 aa AA seqDB search
MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKF
NNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQ
TLSCYSEVWVVPWLQHFEVPVLRCH
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcggctggaactctgctggccttctgctgcctggtcttgagcaccactgggggc
ccttccccagatacttgttcccaggaccttaactcacgtgtgaagccaggatttcctaaa
acaataaagaccaatgacccaggagtcctccaagcagccagatacagtgttgaaaagttc
aacaactgcacgaacgacatgttcttgttcaaggagtcccgcatcacaagggccctagtt
cagatagtgaaaggcctgaaatatatgctggaggtggaaattggcagaactacctgcaag
aaaaaccagcacctgcgtctggatgactgtgacttccaaaccaaccacaccttgaagcag
actctgagctgctactctgaagtctgggtcgtgccctggctccagcacttcgaggtgcct
gttctccgttgtcactga

DBGET integrated database retrieval system