KEGG   Homo sapiens (human): 85301Help
Entry
85301             CDS       T01001                                 

Gene name
COL27A1, STLS
Definition
(RefSeq) collagen type XXVII alpha 1 chain
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    85301 (COL27A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    85301 (COL27A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   85301 (COL27A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 85301
NCBI-ProteinID: NP_116277
OMIM: 608461
HGNC: 22986
Ensembl: ENSG00000196739
Vega: OTTHUMG00000020537
Pharos: Q8IZC6(Tbio)
UniProt: Q8IZC6
Position
9q32
AA seq 1860 aa AA seqDB search
MGAGSARGARGTAAAAAARGGGFLFSWILVSFACHLASTQGAPEDVDILQRLGLSWTKAG
SPAPPGVIPFQSGFIFTQRARLQAPTGTVIPAALGTELALVLSLCSHRVNHAFLFAVRSQ
KRKLQLGLQFLPGKTVVHLGSRRSVAFDLDMHDGRWHHLALELRGRTVTLVTACGQRRVP
VLLPFHRDPALDPGGSFLFGKMNPHAVQFEGALCQFSIYPVTQVAHNYCTHLRKQCGQAD
TYQSPLGPLFSQDSGRPFTFQSDLALLGLENLTTATPALGSLPAGRGPRGTVAPATPTKP
QRTSPTNPHQHMAVGGPAQTPLLPAKLSASNALDPMLPASVGGSTRTPRPAAAQPSQKIT
ATKIPKSLPTKPSAPSTSIVPIKSPHPTQKTAPSSFTKSALPTQKQVPPTSRPVPARVSR
PAEKPIQRNPGMPRPPPPSTRPLPPTTSSSKKPIPTLARTEAKITSHASKPASARTSTHK
PPPFTALSSSPAPTPGSTRSTRPPATMVPPTSGTSTPRTAPAVPTPGSAPTGSKKPIGSE
ASKKAGPKSSPRKPVPLRPGKAARDVPLSDLTTRPSPRQPQPSQQTTPALVLAPAQFLSS
SPRPTSSGYSIFHLAGSTPFPLLMGPPGPKGDCGLPGPPGLPGLPGIPGARGPRGPPGPY
GNPGLPGPPGAKGQKGDPGLSPGKAHDGAKGDMGLPGLSGNPGPPGRKGHKGYPGPAGHP
GEQGQPGPEGSPGAKGYPGRQGLPGPVGDPGPKGSRGYIGLPGLFGLPGSDGERGLPGVP
GKRGKMGMPGFPGVFGERGPPGLDGNPGELGLPGPPGVPGLIGDLGVLGPIGYPGPKGMK
GLMGSVGEPGLKGDKGEQGVPGVSGDPGFQGDKGSQGLPGFPGARGKPGPLGKVGDKGSI
GFPGPPGPEGFPGDIGPPGDNGPEGMKGKPGARGLPGPRGQLGPEGDEGPMGPPGAPGLE
GQPGRKGFPGRPGLDGVKGEPGDPGRPGPVGEQGFMGFIGLVGEPGIVGEKGDRGMMGPP
GVPGPKGSMGHPGMPGGMGTPGEPGPQGPPGSRGPPGMRGAKGRRGPRGPDGPAGEQGSR
GLKGPPGPQGRPGRPGQQGVAGERGHLGSRGFPGIPGPSGPPGTKGLPGEPGPQGPQGPI
GPPGEMGPKGPPGAVGEPGLPGEAGMKGDLGPLGTPGEQGLIGQRGEPGLEGDSGPMGPD
GLKGDRGDPGPDGEHGEKGQEGLMGEDGPPGPPGVTGVRGPEGKSGKQGEKGRTGAKGAK
GYQGQLGEMGVPGDPGPPGTPGPKGSRGSLGPTGAPGRMGAQGEPGLAGYDGHKGIVGPL
GPPGPKGEKGEQGEDGKAEGPPGPPGDRGPVGDRGDRGEPGDPGYPGQEGVQGLRGKPGQ
QGQPGHPGPRGWPGPKGSKGAEGPKGKQGKAGAPGRRGVQGLQGLPGPRGVVGRQGLEGI
AGPDGLPGRDGQAGQQGEQGDDGDPGPMGPAGKRGNPGVAGLPGAQGPPGFKGESGLPGQ
LGPPGKRGTEGRTGLPGNQGEPGSKGQPGDSGEMGFPGMAGLFGPKGPPGDIGFKGIQGP
RGPPGLMGKEGIVGPLGILGPSGLPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGG
PIQLQQDDLGAAFQTWMDTSGALRPESYSYPDRLVLDQGGEIFKTLHYLSNLIQSIKTPL
GTKENPARVCRDLMDCEQKMVDGTYWVDPNLGCSSDTIEVSCNFTHGGQTCLKPITASKV
EFAISRVQMNFLHLLSSEVTQHITIHCLNMTVWQEGTGQTPAKQAVRFRAWNGQIFEAGG
QFRPEVSMDGCKVQDGRWHQTLFTFRTQDPQQLPIISVDNLPPASSGKQYRLEVGPACFL
NT seq 5583 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgggatcggcgcggggggcccgaggcacagcggcggcggcggcggcgcgcggg
ggggggtttctcttctcctggatcttagtctcgtttgcctgtcacctggcctccacccaa
ggagctcctgaagatgtggacatcctccagcggctgggcctcagctggacgaaggccggg
agccctgcacccccgggagtcattcctttccagtcgggcttcatctttacgcagcgggcc
cggctccaggctcccacgggcaccgtcattcctgccgccttgggcacagagctggcactg
gtgctgagcctctgctcccaccgggtgaaccatgccttcctcttcgctgtccgcagccag
aaacgcaagctgcagctgggcctgcagttcctccccggcaagacggtcgtccacctcggg
tcccggcgctcagtggccttcgacctcgacatgcacgacgggcgctggcaccacctggcc
ctcgagctccgaggccgcacagtcactctggtgactgcctgcgggcagcgccgggtgcct
gtcctgctgcctttccacagggaccctgcactcgaccctgggggctccttcctctttggg
aagatgaacccgcatgcagtccagtttgaaggtgctctctgccagttcagtatctaccct
gtgacgcaggtcgctcacaattactgtacccacctgaggaagcagtgtggacaggctgac
acgtaccagtccccactgggacctctcttctcccaagactctggcagaccttttaccttc
cagtccgacctcgccctgctaggcctggagaacttgaccactgccacaccagccctgggg
tcactgccagcaggcaggggacccagggggactgtggcacccgccacgcccaccaagccc
caaaggactagccccacaaaccctcaccagcatatggcggtgggaggcccagcccaaacc
ccgctgctacctgccaagctgtcagccagtaacgcacttgatcccatgctcccagcctct
gttggcggctctaccagaacgcctcgccctgcggccgctcaaccatcacagaagatcaca
gccaccaaaatccccaaaagcctccctaccaagccttcggccccttctacttcaattgtg
cccatcaaaagcccccatcctacccagaaaacagctccatcttcatttacaaagtcagcc
ctacccactcagaagcaagtgccacctacttcccgtccagttcctgccagagtctcccgt
cccgcagagaagcccatccagaggaacccgggaatgcccaggcccccaccgcccagcacc
cggcccctacctcctaccaccagctcctctaaaaaacccattcccacactagctcggact
gaggccaagataaccagccatgccagtaagccggcctctgcccgcaccagcacccacaaa
cctcccccatttactgctttatcctcatctcctgcccctactcctggttctaccaggagt
actcggccaccagccacgatggtacctccaacttcgggcaccagcactcccagaacagca
cctgccgtccccactcctggctcagctcccactggaagcaagaagcccattggatcggaa
gcctcaaagaaagccggacccaagagcagcccccggaagcctgtccccctcagacctggg
aaggcagccagggatgtccccttgagcgatctgacaaccaggcctagccccagacagccc
cagcccagtcagcagaccaccccggccctggtattggccccggcgcaattcctgtcctcc
agcccccggcccacgagcagtggctattcgatcttccacctggcaggatctacgcctttc
cctctgctgatggggcctccgggacccaagggagactgtggcttgccgggtccccctggg
ctacctgggctacctggaatccctggtgcacgtgggcctcggggtcctcctgggccttat
ggaaatccaggtctccccggccctcctggagccaaaggacagaaaggggacccagggctc
tcaccaggaaaggcccacgatggggcaaagggtgacatgggcttgcctgggctctccggg
aatccaggacctccgggacgaaagggacacaagggctatcctggaccggcagggcacccc
ggagaacaggggcagccaggacctgagggcagcccaggggccaaaggttaccctggcagg
caggggttacctggaccggtaggagatcccggccccaaaggcagcaggggctacattggg
ctcccagggctcttcggcctgccagggtctgatggagaacgaggcctgcctggcgttcct
ggcaagaggggcaagatgggtatgccggggtttcctggagtctttggggaaagaggccct
cctggactggatggaaatcctggagaactgggcctgccaggcccccctggagtccccggc
ctcattggtgacttaggagtgttgggtccgattggctacccgggacccaagggcatgaag
ggactgatgggcagcgtgggggagcccggactgaaaggtgataagggtgaacaaggggtt
ccaggtgtgtcaggagatcccggattccaaggagacaaggggagccaggggttgccaggg
ttccccggtgcacgggggaagccagggcctctgggcaaagtcggagacaaaggatccatt
gggtttcccgggccccctggacccgagggattcccaggagacatcggcccccctggcgac
aatggcccagaaggcatgaagggtaagcctggagcccgaggcctgccgggaccccgtggg
cagctggggcccgagggagatgagggacccatggggccgccaggggcccctggcttggag
ggtcagcctggcaggaaggggtttcctgggaggcccggcctggatggcgtgaagggggaa
ccaggggatcctggtcggccggggcctgtgggagagcagggatttatgggattcattggt
ctggtcggggagccaggaatcgtgggagaaaagggtgatcgtggcatgatgggaccccca
ggcgtgcctggacccaaggggtcgatgggtcatcctggaatgccaggtggtatggggacc
cctggagagcctggaccccagggtcctccaggatctcgaggcccaccaggcatgagggga
gcaaagggacgtcggggcccccgaggaccggacggaccagctggggagcaagggtccagg
ggcctgaagggccctccaggaccccagggcagaccgggccggcctggacagcagggtgtg
gctggtgagcgaggccacttgggctcgagaggctttcctggcatcccgggtccctcaggc
cccccaggcaccaagggcctcccaggagaaccgggccctcagggaccccaggggccaatt
gggcctccaggagagatgggacccaaggggccgcctggtgcagtgggagaaccgggcctt
cctggggaagccgggatgaagggtgaccttggacccctgggcactcctggggagcagggc
ctcattgggcaacggggagagccaggccttgagggtgacagtggccccatgggacctgat
gggctgaagggggacaggggagacccagggcctgatggagaacatggcgagaaaggccag
gaagggctgatgggtgaggacgggccccccggcccccctggcgtcactggtgtccggggt
cctgaaggaaaatcagggaagcaaggcgagaagggccgcactggagccaagggtgccaag
ggctatcaaggacagctgggtgagatgggcgtccctggagaccctggaccccctggcact
ccaggccctaaagggtcccggggcagcctgggaccaacgggtgctccgggacgcatgggg
gcccaaggagaaccgggactggctggttatgatggacacaaaggcattgtgggacccctt
ggacctcctggaccaaaaggcgaaaagggggagcagggcgaggacggcaaggctgagggg
ccccctgggccacctggagatcggggccctgtgggtgatcgaggagaccgcggggaaccg
ggagaccctgggtaccctggacaggagggtgtgcaaggcctccgtggaaagccaggccag
cagggccaacccgggcatccgggaccccgggggtggccgggacccaaaggatcgaaaggc
gcagagggaccaaagggaaagcaaggcaaggcaggggccccaggccggaggggggtccag
ggcctgcaggggctgccagggccccggggcgtggtggggagacagggcctcgagggcatc
gctggaccagatgggcttcctggcagggacgggcaagcaggacagcagggggagcaggga
gacgatggggaccctggccccatgggccctgctgggaagagaggaaatccaggtgtggcc
ggcttacctggagcacagggacccccaggattcaagggtgagagtgggttacccggacag
ctgggtccccctggcaagcgaggaacagagggcagaacggggctccctggaaaccagggg
gagcctgggtccaaaggccagccgggcgactctggcgagatgggcttcccaggaatggca
ggtctcttcggacccaagggcccgcctggagacattggcttcaaaggcatccagggccct
cgggggccacctggcttgatgggaaaggaaggcatcgtcgggcccctcggaatcctggga
ccttcgggactcccgggtccgaagggtgacaaaggcagccgtggggactggggattgcaa
ggtccgaggggtcctcccggccccagagggcggcccggccccccgggtcctccagggggt
cctatccaattgcaacaagatgatcttggggcagctttccagacgtggatggacaccagt
ggagcactcaggccagagagttacagctatccagaccggctggtgctggaccagggagga
gagatctttaaaaccttacactacctcagcaacctcatccagagcattaagacgcccctg
ggcaccaaagagaaccccgcccgggtctgcagggacctcatggactgtgagcagaagatg
gtggatggtacctactgggtggatccaaaccttggctgctcctctgacaccatcgaggtc
tcctgcaacttcactcatggtggacagacgtgtctcaagcccatcacggcctccaaggtc
gagtttgccatcagccgggtccagatgaatttcctgcacctgctaagctccgaggtgacc
cagcacatcaccatccactgccttaacatgaccgtgtggcaggagggcactgggcagacc
ccagccaagcaggccgtacgcttccgggcctggaatggacagatttttgaagctgggggt
cagttccggcccgaggtgtccatggatggctgcaaggtccaagatggccgctggcatcag
acactcttcaccttccggacccaagacccccaacagctgcccatcatcagtgtggacaac
ctccctcctgcctcatcagggaagcagtaccgcctggaagttggacctgcgtgcttcctc
tga

DBGET integrated database retrieval system