KEGG   Homo sapiens (human): 85313
Entry
85313             CDS       T01001                                 

Gene name
PPIL4, HDCME13P
Definition
(RefSeq) peptidylprolyl isomerase like 4
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    85313 (PPIL4)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    85313 (PPIL4)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     85313 (PPIL4)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   PPlases
    85313 (PPIL4)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    85313 (PPIL4)
SSDB
Motif
Pfam: Pro_isomerase RRM_1 RRM_5
Other DBs
NCBI-GeneID: 85313
NCBI-ProteinID: NP_624311
OMIM: 607609
HGNC: 15702
Ensembl: ENSG00000131013
Vega: OTTHUMG00000015788
Pharos: Q8WUA2(Tdark)
UniProt: Q8WUA2
Position
6q25.1
AA seq 492 aa
MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCLIHNVQRDFIIQTGDPTGTG
RGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLD
GVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDPPDLLIPDRSPE
PTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGDLPDADIKPPEN
VLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFEKEEDCEKAFFK
MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQD
TKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHY
EEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSP
KKSKDKEKSKYR
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggcggttctactggagaccactttaggcgacgtcgtcatcgacttgtacaccgaagaa
cggccgcgtgcctgcttgaatttcttgaaactgtgcaaaataaaatattacaattattgc
cttattcacaatgtacagagggattttatcatacaaactggcgatcctacagggactggc
cgtggaggagagtctatctttggccaactgtatggtgatcaagcaagcttttttgaggca
gaaaaagtcccaagaattaagcacaagaagaaaggcacagtgtccatggtgaataatggc
agtgatcaacatggatctcagtttcttatcaccacaggagaaaatctagattatcttgat
ggtgtccatacggtgtttggtgaggtgacagaaggcatggacataattaagaaaattaat
gagacctttgttgacaaggactttgtaccatatcaggatatcaggataaatcatacggtg
attttagatgatccatttgatgaccctcctgatttattaatccctgatcgatcaccagaa
cctacaagggaacaattagatagtggtcgaataggagcagatgaagaaattgatgatttc
aaaggaagatcagctgaggaagtagaagaaataaaggcagaaaaagaggctaaaactcag
gctatacttttggagatggtgggagacctacctgatgcagatattaaacctccagaaaat
gtactgtttgtgtgtaaattgaacccagtgaccacagatgaggatctggaaataatattc
tctagatttgggccaataagaagttgtgaagttatccgagactggaagacaggagagtcc
ctctgttacgcttttattgaatttgaaaaggaagaagattgtgagaaagcattcttcaaa
atggacaatgtgcttatagatgacagaagaatacatgtggattttagccagtcggttgca
aaggttaaatggaaaggaaaaggtgggaaatacaccaagagtgatttcaaggagtatgaa
aaagaacaggataaaccacctaatttggttctgaaagataaagtaaagcccaaacaggat
acaaaatacgatcttatattagatgagcaggccgaagactcaaaatcaagtcactcacac
acaagtaaaaaacacaagaagaaaacccatcactgttctgaagagaaagaagatgaggac
tacatgccaatcaaaaatactaatcaggatatctatagagaaatggggtttggtcactat
gaagaagaagaaagctgttgggagaaacaaaagagtgaaaagagagaccgaactcagaac
cgaagtcgtagccgatctcgagagagggatggccattatagtaatagtcataaatcaaaa
taccaaacagatctttatgaaagagaaaggagtaaaaagagagaccgaagcagaagtcca
aagaagtccaaagataaagaaaaatctaagtatagatga

DBGET integrated database retrieval system