KEGG   Homo sapiens (human): 8532
Entry
8532              CDS       T01001                                 
Symbol
CPZ
Name
(RefSeq) carboxypeptidase Z
  KO
K13022  carboxypeptidase Z [EC:3.4.17.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    8532 (CPZ)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.-
     8532 (CPZ)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   8532 (CPZ)
SSDB
Motif
Pfam: Peptidase_M14 Fz CarboxypepD_reg AstE_AspA CarbopepD_reg_2
Other DBs
NCBI-GeneID: 8532
NCBI-ProteinID: NP_001014447
OMIM: 603105
HGNC: 2333
Ensembl: ENSG00000109625
Pharos: Q66K79(Tdark)
UniProt: Q66K79 A0A384MDV6
Position
4:8592765..8619752
AA seq 652 aa
MPPPLPLLLLTVLVVAAARPGCEFERNPAGECHRPPAADSATCVDLQLRTCSDAAYNHTT
FPNLLQHRSWEVVEASSEYILLSVLHQLLEGQCNPDLRLLGCAVLAPRCEGGWVRRPCRH
ICEGLREVCQPAFDAIDMAWPYFLDCHRYFTREDEGCYDPLEKLRGGLEADEALPSGLPP
TFIRFSHHSYAQMVRVLRRTASRCAHVARTYSIGRSFDGRELLVIEFSSRPGQHELMEPE
VKLIGNIHGNEVAGREMLIYLAQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAA
AEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIPQHYWWGKVAPE
TKAIMKWMQTIPFVLSASLHGGDLVVSYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYAD
VHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPP
EEALYILWQHNKESLLNFVETVHRGIKGVVTDKFGKPVKNARISVKGIRHDITTAPDGDY
WRLLPPGIHIVIAQAPGYAKVIKKVIIPARMKRAGRVDFILQPLGMGPKNFIHGLRRTGP
HDPLGGASSLGEATEPDPLRARRQPSADGSKPWWWSYFTSLSTHRPRWLLKY
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgccgcccccgctgccgctgctgctccttacagtcctggtcgtcgccgctgcccggccg
gggtgcgagtttgagcggaaccccgccggtgaatgccacaggccaccagctgcagacagc
gccacctgcgtggacctgcagctcaggacctgcagcgatgccgcctacaaccacaccacc
ttccccaacctgcttcagcaccggtcgtgggaggtggtggaggccagctccgagtacatc
ctgctgagcgttctacaccagctcctggaaggccagtgcaacccggacctgcggctgctg
ggctgtgctgtgctggccccccggtgtgagggcggctgggtgcgcagaccctgccggcac
atctgcgagggcctgcgggaggtctgccagcccgccttcgacgccattgacatggcctgg
ccctacttccttgactgccaccgctacttcacgagagaggacgagggctgctatgacccg
ctggagaagcttcggggaggcctggaggctgacgaggcactgccctcagggctgccgccc
accttcatccgcttcagccaccactcctacgcccagatggtgcgtgtgctgaggcggacg
gcctcccgctgcgcccacgtggccaggacctacagcatcgggcgcagcttcgacggcagg
gagctgctggtcatcgagttctccagccgccccggccagcacgagctgatggagcccgag
gtgaagctcatcggcaacattcatggcaacgaggtggcgggccgggagatgctcatctac
ctagcccagtacctgtgctctgagtacctgcttggtaacccccgcatccagcgcctgctc
aacaccacccgcatccacctgctgccctccatgaaccctgacggctatgaggtggcagct
gccgagggtgccggctacaacgggtggacgagcgggaggcagaacgcgcagaacctggat
ctgaaccgaaatttcccggacctgacgtccgagtactaccggctggcggagacccgcggc
gcacgcagcgaccacatccccatcccccagcactactggtggggtaaggtggccccggag
acaaaggcaatcatgaagtggatgcagaccataccctttgtgctctcagccagccttcat
gggggcgacctggtggtgtcctaccccttcgacttctccaagcacccccaggaggagaag
atgttttctcccacgcccgacgagaagatgttcaagctgctgtccagagcctacgctgac
gtccaccccatgatgatggacaggtcggagaataggtgtggaggcaatttcctgaagagg
gggagcatcatcaacggggcggactggtacagcttcacgggaggcatgtccgatttcaac
tacctgcacaccaactgctttgagatcacggtagagctgggctgtgtgaagttccccccc
gaggaggccctgtacatactctggcagcacaacaaggagtcactcctgaatttcgtggag
acggtgcaccggggcatcaaaggtgtggtgacagataaattcggcaagccagtcaaaaac
gcccggatctcagtcaaaggcattcgccacgacatcaccacagccccagatggtgactac
tggagactgctgcccccaggtatccacattgtcattgcccaagcccctggctacgccaaa
gtcatcaagaaagtcatcatccccgcccggatgaagagggctggccgtgtggacttcatt
ctgcaacctctggggatgggacccaagaactttattcatgggctgcggaggactgggccc
cacgacccactgggaggtgccagctctttgggggaggccacggagcccgacccgctccgg
gcgcgcaggcagccctcggccgacgggagtaagccctggtggtggtcctacttcacatcg
ctgagcacccacaggccacgctggctgctcaagtactag

DBGET integrated database retrieval system