KEGG   Homo sapiens (human): 85320Help
Entry
85320             CDS       T01001                                 

Gene name
ABCC11, EWWD, MRP8, WW
Definition
(RefSeq) ATP binding cassette subfamily C member 11
  KO
K05671  ATP-binding cassette, subfamily C (CFTR/MRP), member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    85320 (ABCC11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    85320 (ABCC11)
Transporters [BR:hsa02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    85320 (ABCC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N T2SSE AAA_29 DUF87 MMR_HSR1 AAA_16 AAA_23 RsgA_GTPase Dynamin_N
Motif
Other DBs
NCBI-GeneID: 85320
NCBI-ProteinID: NP_115972
OMIM: 607040
HGNC: 14639
Ensembl: ENSG00000121270
Vega: OTTHUMG00000133146
Pharos: Q96J66(Tbio)
UniProt: Q96J66 A0A024R6Q6
Position
16q12.1
AA seq 1382 aa AA seqDB search
MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWSQQERNPEAPGRAAVPP
WGKYDAALRTMIPFRPKPRFPAPQPLDNAGLFSYLTVSWLTPLMIQSLRSRLDENTIPPL
SVHDASDKNVQRLHRLWEEEVSRRGIEKASVLLVMLRFQRTRLIFDALLGICFCIASVLG
PILIIPKILEYSEEQLGNVVHGVGLCFALFLSECVKSLSFSSSWIINQRTAIRFRAAVSS
FAFEKLIQFKSVIHITSGEAISFFTGDVNYLFEGVCYGPLVLITCASLVICSISSYFIIG
YTAFIAILCYLLVFPLAVFMTRMAVKAQHHTSEVSDQRIRVTSEVLTCIKLIKMYTWEKP
FAKIIEDLRRKERKLLEKCGLVQSLTSITLFIIPTVATAVWVLIHTSLKLKLTASMAFSM
LASLNLLRLSVFFVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEAT
LSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSKGMML
GVCGNTGSGKSSLLSAILEEMHLLEGSVGVQGSLAYVPQQAWIVSGNIRENILMGGAYDK
ARYLQVLHCCSLNRDLELLPFGDMTEIGERGLNLSGGQKQRISLARAVYSDRQIYLLDDP
LSAVDAHVGKHIFEECIKKTLRGKTVVLVTHQLQYLEFCGQIILLENGKICENGTHSELM
QKKGKYAQLIQKMHKEATSDMLQDTAKIAEKPKVESQALATSLEESLNGNAVPEHQLTQE
EEMEEGSLSWRVYHHYIQAAGGYMVSCIIFFFVVLIVFLTIFSFWWLSYWLEQGSGTNSS
RESNGTMADLGNIADNPQLSFYQLVYGLNALLLICVGVCSSGIFTKVTRKASTALHNKLF
NKVFRCPMSFFDTIPIGRLLNCFAGDLEQLDQLLPIFSEQFLVLSLMVIAVLLIVSVLSP
YILLMGAIIMVICFIYYMMFKKAIGVFKRLENYSRSPLFSHILNSLQGLSSIHVYGKTED
FISQFKRLTDAQNNYLLLFLSSTRWMALRLEIMTNLVTLAVALFVAFGISSTPYSFKVMA
VNIVLQLASSFQATARIGLETEAQFTAVERILQYMKMCVSEAPLHMEGTSCPQGWPQHGE
IIFQDYHMKYRDNTPTVLHGINLTIRGHEVVGIVGRTGSGKSSLGMALFRLVEPMAGRIL
IDGVDICSIGLEDLRSKLSVIPQDPVLLSGTIRFNLDPFDRHTDQQIWDALERTFLTKAI
SKFPKKLHTDVVENGGNFSVGERQLLCIARAVLRNSKIILIDEATASIDMETDTLIQRTI
REAFQGCTVLVIAHRVTTVLNCDHILVMGNGKVVEFDRPEVLRKKPGSLFAALMATATSS
LR
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgactaggaagaggacatactgggtgcccaactcttctggtggcctcgtgaatcgtggc
atcgacataggcgatgacatggtttcaggacttatttataaaacctatactctccaagat
ggcccctggagtcagcaagagagaaatcctgaggctccagggagggcagctgtcccaccg
tgggggaagtatgatgctgccttgagaaccatgattcccttccgtcccaagccgaggttt
cctgccccccagcccctggacaatgctggcctgttctcctacctcaccgtgtcatggctc
accccgctcatgatccaaagcttacggagtcgcttagatgagaacaccatccctccactg
tcagtccatgatgcctcagacaaaaatgtccaaaggcttcaccgcctttgggaagaagaa
gtctcaaggcgagggattgaaaaagcttcagtgcttctggtgatgctgaggttccagaga
acaaggttgattttcgatgcacttctgggcatctgcttctgcattgccagtgtactcggg
ccaatattgattataccaaagatcctggaatattcagaagagcagttggggaatgttgtc
catggagtgggactctgctttgccctttttctctccgaatgtgtgaagtctctgagtttc
tcctccagttggatcatcaaccaacgcacagccatcaggttccgagcagctgtttcctcc
tttgcctttgagaagctcatccaatttaagtctgtaatacacatcacctcaggagaggcc
atcagcttcttcaccggtgatgtaaactacctgtttgaaggggtgtgctatggaccccta
gtactgatcacctgcgcatcgctggtcatctgcagcatttcttcctacttcattattgga
tacactgcatttattgccatcttatgctatctcctggttttcccactggcggtattcatg
acaagaatggctgtgaaggctcagcatcacacatctgaggtcagcgaccagcgcatccgt
gtgaccagtgaagttctcacttgcattaagctgattaaaatgtacacatgggagaaacca
tttgcaaaaatcattgaagacctaagaaggaaggaaaggaaactattggagaagtgcggg
cttgtccagagcctgacaagtataaccttgttcatcatccccacagtggccacagcggtc
tgggttctcatccacacatccttaaagctgaaactcacagcgtcaatggccttcagcatg
ctggcctccttgaatctccttcggctgtcagtgttctttgtgcctattgcagtcaaaggt
ctcacgaattccaagtctgcagtgatgaggttcaagaagtttttcctccaggagagccct
gttttctatgtccagacattacaagaccccagcaaagctctggtctttgaggaggccacc
ttgtcatggcaacagacctgtcccgggatcgtcaatggggcactggagctggagaggaac
gggcatgcttctgaggggatgaccaggcctagagatgccctcgggccagaggaagaaggg
aacagcctgggcccagagttgcacaagatcaacctggtggtgtccaaggggatgatgtta
ggggtctgcggcaacacggggagtggtaagagcagcctgttgtcagccatcctggaggag
atgcacttgctcgagggctcggtgggggtgcagggaagcctggcctatgtcccccagcag
gcctggatcgtcagcgggaacatcagggagaacatcctcatgggaggcgcatatgacaag
gcccgatacctccaggtgctccactgctgctccctgaatcgggacctggaacttctgccc
tttggagacatgacagagattggagagcggggcctcaacctctctggggggcagaaacag
aggatcagcctggcccgcgccgtctattccgaccgtcagatctacctgctggacgacccc
ctgtctgctgtggacgcccacgtggggaagcacatttttgaggagtgcattaagaagaca
ctcagggggaagacggtcgtcctggtgacccaccagctgcagtacttagaattttgtggc
cagatcattttgttggaaaatgggaaaatctgtgaaaatggaactcacagtgagttaatg
cagaaaaaggggaaatatgcccaacttatccagaagatgcacaaggaagccacttcggac
atgttgcaggacacagcaaagatagcagagaagccaaaggtagaaagtcaggctctggcc
acctccctggaagagtctctcaacggaaatgctgtgccggagcatcagctcacacaggag
gaggagatggaagaaggctccttgagttggagggtctaccaccactacatccaggcagct
ggaggttacatggtctcttgcataattttcttcttcgtggtgctgatcgtcttcttaacg
atcttcagcttctggtggctgagctactggttggagcagggctcggggaccaatagcagc
cgagagagcaatggaaccatggcagacctgggcaacattgcagacaatcctcaactgtcc
ttctaccagctggtgtacgggctcaacgccctgctcctcatctgtgtgggggtctgctcc
tcagggattttcaccaaggtcacgaggaaggcatccacggccctgcacaacaagctcttc
aacaaggttttccgctgccccatgagtttctttgacaccatcccaataggccggcttttg
aactgcttcgcaggggacttggaacagctggaccagctcttgcccatcttttcagagcag
ttcctggtcctgtccttaatggtgatcgccgtcctgttgattgtcagtgtgctgtctcca
tatatcctgttaatgggagccataatcatggttatttgcttcatttattatatgatgttc
aagaaggccatcggtgtgttcaagagactggagaactatagccggtctcctttattctcc
cacatcctcaattctctgcaaggcctgagctccatccatgtctatggaaaaactgaagac
ttcatcagccagtttaagaggctgactgatgcgcagaataactacctgctgttgtttcta
tcttccacacgatggatggcattgaggctggagatcatgaccaaccttgtgaccttggct
gttgccctgttcgtggcttttggcatttcctccaccccctactcctttaaagtcatggct
gtcaacatcgtgctgcagctggcgtccagcttccaggccactgcccggattggcttggag
acagaggcacagttcacggctgtagagaggatactgcagtacatgaagatgtgtgtctcg
gaagctcctttacacatggaaggcacaagttgtccccaggggtggccacagcatggggaa
atcatatttcaggattatcacatgaaatacagagacaacacacccaccgtgcttcacggc
atcaacctgaccatccgcggccacgaagtggtgggcatcgtgggaaggacgggctctggg
aagtcctccttgggcatggctctcttccgcctggtggagcccatggcaggccggattctc
attgacggcgtggacatttgcagcatcggcctggaggacttgcggtccaagctctcagtg
atccctcaagatccagtgctgctctcaggaaccatcagattcaacctagatccctttgac
cgtcacactgaccagcagatctgggatgccttggagaggacattcctgaccaaggccatc
tcaaagttccccaaaaagctgcatacagatgtggtggaaaacggtggaaacttctctgtg
ggggagaggcagctgctctgcattgccagggctgtgcttcgcaactccaagatcatcctt
atcgatgaagccacagcctccattgacatggagacagacaccctgatccagcgcacaatc
cgtgaagccttccagggctgcaccgtgctcgtcattgcccaccgtgtcaccactgtgctg
aactgtgaccacatcctggttatgggcaatgggaaggtggtagaatttgatcggccggag
gtactgcggaagaagcctgggtcattgttcgcagccctcatggccacagccacttcttca
ctgagataa

DBGET integrated database retrieval system