KEGG   Homo sapiens (human): 85352
Entry
85352             CDS       T01001                                 

Gene name
SHISAL1, KIAA1644
Definition
(RefSeq) shisa like 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Shisa
Other DBs
NCBI-GeneID: 85352
NCBI-ProteinID: NP_001092764
HGNC: 29335
Ensembl: ENSG00000138944
Vega: OTTHUMG00000030991
UniProt: Q3SXP7
Position
22q13.31
AA seq 199 aa
MTSCGQQSLNVLAVLFSLLFSAVLSAHFRVCEPYTDHKGRYHFGFHCPRLSDNKTFILCC
HHNNTVFKYCCNETEFQAVMQANLTASSEGYMHNNYTALLGVWIYGFFVLMLLVLDLLYY
SAMNYDICKVYLARWGIQGRWMKQDPRRWGNPARAPRPGQRAPQPQPPPGPLPQAPQAVH
TLRGDAHSPPLMTFQSSSA
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaccagttgtggccagcagtccttgaacgtgctcgccgtcctcttctcattgctgttt
tctgcagtcttgtctgcacatttccgggtctgtgaaccatacacagaccacaaaggccgc
taccactttggcttccactgcccccggctctcggacaacaagaccttcatcctctgttgt
caccataacaacacggtcttcaaatactgctgcaacgagacggagttccaggcggtgatg
caggcgaacctcacggccagctccgagggttacatgcacaacaattacaccgccttgttg
ggagtgtggatctatggatttttcgtgttgatgctgctggttctggaccttttgtattac
tcggcaatgaactacgacatctgcaaggtctacctggcacggtggggcatccaaggacga
tggatgaaacaggacccccggcggtgggggaaccccgctcgggcccctcggccgggtcag
cgggccccacagccgcagcctcccccaggcccgctgccacaagccccacaggccgtgcac
acattgcggggagatgctcacagcccaccgctgatgaccttccagagttcgtctgcctga

DBGET integrated database retrieval system