KEGG   Homo sapiens (human): 8538
Entry
8538              CDS       T01001                                 

Gene name
BARX2
Definition
(RefSeq) BARX homeobox 2
  KO
K09361  BarH-like homeobox
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8538 (BARX2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    8538 (BARX2)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 8538
NCBI-ProteinID: NP_003649
OMIM: 604823
HGNC: 956
Ensembl: ENSG00000043039
Vega: OTTHUMG00000165776
Pharos: Q9UMQ3(Tdark)
UniProt: Q9UMQ3
Position
11q24.3
AA seq 279 aa
MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHS
CTGSPSLRAYPLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSE
SETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTW
YQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQGQ
EELCEAQEPKARDVPLEMAEPPDPPQELPIPSSEPPPLS
NT seq 840 nt   +upstreamnt  +downstreamnt
atgcactgccacgccgagctgaggctgagctcgcccggccagctcaaagcagccaggcgg
cgctacaagactttcatgatcgacgagatcctctccaaggagacctgcgattactttgag
aaactttccctctactccgtgtgcccgtcgctggtcgtgcgacccaagcccctgcattcc
tgtacgggctccccttccctgcgggcatatccgctcctctcggtgatcacccgccagccc
actgtcatctcccacctggtccctgccaccccgggaatcgcccaggcactgtcctgccac
caggtcaccgaggcggtctctgctgaggccccagggggcgaggccctagccagcagcgag
tcagagacggaacagcccacgccccgacagaagaagccccgccggagtcgcaccatcttc
accgagctgcagctcatgggcctggagaagaaattccagaagcagaagtatttgtcaacc
ccagacaggttggacttggctcagtctctgggactcactcagctgcaggtgaagacctgg
tatcagaatcgcaggatgaaatggaagaaaatggttcttaaaggtggacaggaagcaccc
acaaaacccaaaggtcgccccaagaagaactccatccccacatcagaagagattgaagct
gaagagaagatgaacagccaggcccagggtcaggagcagctggagccctctcaggggcag
gaggagctctgtgaagcacaggaaccgaaagcacgtgatgtccccttagagatggcagag
ccaccagacccgccccaggagttgccaataccctcttcggaacccccaccattaagctaa

DBGET integrated database retrieval system